KEGG   Homo sapiens (human): 117177Help
Entry
117177            CDS       T01001                                 

Gene name
RAB3IP, RABIN3, RABIN8
Definition
(RefSeq) RAB3A interacting protein
  KO
K16779  Rab-3A-interacting protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    117177 (RAB3IP)
   03036 Chromosome and associated proteins [BR:hsa03036]
    117177 (RAB3IP)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    117177 (RAB3IP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    117177 (RAB3IP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec2p FAM76 UPF0242 DUF3584 GCN5L1 Spc7
Motif
Other DBs
NCBI-GeneID: 117177
NCBI-ProteinID: NP_783322
OMIM: 608686
HGNC: 16508
Ensembl: ENSG00000127328
Vega: OTTHUMG00000169437
Pharos: Q96QF0(Tbio)
UniProt: Q96QF0
Structure
PDB: 

Position
12q15
AA seq 476 aa AA seqDB search
MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPH
PSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTK
LTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEE
LAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKE
AQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDL
SVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAV
LEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYIS
PFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaaaaagatgaaagggttatcttatgatgaggcttttgctatggctaatgat
cccttggaaggcttccatgaagtaaaccttgcttcacctacttctccggaccttcttggt
gtgtatgaatcaggaactcaagagcagactacctcaccaagtgtcatctaccggccacac
ccttcagctttatcctctgtacctatccaggcaaatgcattagatgtttctgaacttcct
acacaacccgtgtattcatcccccagacgtttaaattgtgcggaaatatctagtatcagc
tttcatgttacagacccagccccttgctctacctctggagtcacagctggattaactaaa
ttaactacaagaaaggacaactataatgcagagagagagtttttacagggtgctactata
acagaggcttgcgatggcagtgatgatatttttgggttgagtactgatagtctgtctcgt
ttacgaagcccatctgttttggaagttagagaaaagggctatgaacgattaaaagaagaa
ctcgcaaaagctcagagggaactgaagttaaaagatgaagaatgtgagaggctttcaaaa
gtgcgagatcaacttggacaggaattggaagaactcacagctagtctatttgaggaagct
cataaaatggtgagagaagcaaatatcaagcaggcaacagcagaaaaacagctaaaagaa
gcacaaggaaaaattgatgtacttcaagctgaagtagctgcattgaagacacttgtattg
tccagttctccaacatcacctacgcaggagcctttgccaggtggaaagacaccttttaaa
aaggggcatacaagaaataaaagcacaagcagtgctatgagtggcagtcatcaggacctc
agtgtgatacagccaattgtaaaagactgcaaagaggctgacttatccttgtataatgaa
ttccgattgtggaaggatgagcccacaatggacaggacgtgtcctttcttagacaaaatc
taccaggaagatatctttccatgtttaacattctcaaaaagtgagttggcttcagctgtt
ctggaggctgtggaaaacaatactctaagcattgaaccagtgggattacaacctatccgg
tttgtgaaagcttctgcagttgaatgcggaggaccaaaaaaatgtgctctcactggccag
agtaagtcctgtaaacacagaattaaattaggggactcaagcaactattattatatttct
cctttttgcagatacaggatcacttctgtatgtaacttttttacatacattcgatacatt
cagcagggactcgtgaaacagcaggatgttgatcagatgttttgggaggttatgcagttg
agaaaagagatgtcattggcaaagctgggttatttcaaagaggaactctga

DBGET integrated database retrieval system