KEGG   Homo sapiens (human): 117194
Entry
117194            CDS       T01001                                 

Gene name
MRGPRX2, MGRG3, MRGX2
Definition
(RefSeq) MAS related GPR family member X2
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    117194 (MRGPRX2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    117194 (MRGPRX2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 117194
NCBI-ProteinID: NP_001290544
OMIM: 607228
HGNC: 17983
Ensembl: ENSG00000183695
Vega: OTTHUMG00000166098
Pharos: Q96LB1(Tbio)
UniProt: Q96LB1
Position
11p15.1
AA seq 330 aa
MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMR
RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSML
STVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWC
QTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG
IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL
QRALQDIAEVDHSEGCFRQGTPEMSRSSLV
NT seq 993 nt   +upstreamnt  +downstreamnt
atggatccaaccaccccggcctggggaacagaaagtacaacagtgaatggaaatgaccaa
gcccttcttctgctttgtggcaaggagaccctgatcccggtcttcctgatccttttcatt
gccctggtcgggctggtaggaaacgggtttgtgctctggctcctgggcttccgcatgcgc
aggaacgccttctctgtctacgtcctcagcctggccggggccgacttcctcttcctctgc
ttccagattataaattgcctggtgtacctcagtaacttcttctgttccatctccatcaat
ttccctagcttcttcaccactgtgatgacctgtgcctaccttgcaggcctgagcatgctg
agcaccgtcagcaccgagcgctgcctgtccgtcctgtggcccatctggtatcgctgccgc
cgccccagacacctgtcagcggtcgtgtgtgtcctgctctgggccctgtccctactgctg
agcatcttggaagggaagttctgtggcttcttatttagtgatggtgactctggttggtgt
cagacatttgatttcatcactgcagcgtggctgatttttttattcatggttctctgtggg
tccagtctggccctgctggtcaggatcctctgtggctccaggggtctgccactgaccagg
ctgtacctgaccatcctgctcacagtgctggtgttcctcctctgcggcctgccctttggc
attcagtggttcctaatattatggatctggaaggattctgatgtcttattttgtcatatt
catccagtttcagttgtcctgtcatctcttaacagcagtgccaaccccatcatttacttc
ttcgtgggctcttttaggaagcagtggcggctgcagcagccgatcctcaagctggctctc
cagagggctctgcaggacattgctgaggtggatcacagtgaaggatgcttccgtcagggc
accccggagatgtcgagaagcagtctggtgtag

DBGET integrated database retrieval system