KEGG   Homo sapiens (human): 117245Help
Entry
117245            CDS       T01001                                 

Gene name
HRASLS5, HRLP5, HRSL5, RLP1, iNAT
Definition
(RefSeq) HRAS like suppressor family member 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Peptidase_C97 NLPC_P60
Motif
Other DBs
NCBI-GeneID: 117245
NCBI-ProteinID: NP_473449
OMIM: 611474
HGNC: 24978
Ensembl: ENSG00000168004
Vega: OTTHUMG00000167806
Pharos: Q96KN8(Tbio)
UniProt: Q96KN8 Q8NE88
Position
11q12.3
AA seq 279 aa AA seqDB search
MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSGLNSISPLELE
ESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLI
KQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVV
KYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGL
RYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgagcccgggcgccgagggggagtacgcgctccgcctccctaggattccccca
cccctccccaaacccgcctcgcgaaccgccggtaccgggcccaaggaccagccgcctgcg
ctcagacgttcagctgtgccccactcaggtctaaatagcatttccccccttgaattagaa
gaatccgtgggattcgcagcgttggtccagctcccagccaagcagcctccgccgggcaca
ttagaacagggcagaagcatccagcaaggggagaaggctgtagttagcttggagaccaca
cccagccagaaagcagactggagttcaattccaaagcctgagaatgaaggcaagttaata
aagcaagcagctgagggaaaaccaagacccagacctggagacctgattgagatttttcga
attggctatgagcactgggccatctatgtagaagatgattgcgtggtccatctggctccc
ccaagtgaggagtttgaggtgggcagcattacttccatctttagcaatcgggccgtggtg
aaatacagtcgtctggaggatgtgctgcatggctgctcctggaaggtcaataacaagcta
gatgggacgtacctgcccttgccggtggacaagatcatccagcgtacaaaaaagatggtc
aacaagatcgtgcagtacagcctgattgaagggaactgtgagcactttgtcaatggcctc
agatatggcgtaccccggagccagcaggtagagcacgccctgatggaaggagcgaaggct
gctggagcagttatttcagctgtagtggatagcataaagcccaaaccaataactgcctga

DBGET integrated database retrieval system