KEGG   Homo sapiens (human): 117285
Entry
117285            CDS       T01001                                 

Gene name
DEFB118, C20orf63, DEFB-18, ESC42, ESP13.6
Definition
(RefSeq) defensin beta 118
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2
Other DBs
NCBI-GeneID: 117285
NCBI-ProteinID: NP_473453
OMIM: 607650
HGNC: 16196
Ensembl: ENSG00000131068
Vega: OTTHUMG00000032161
Pharos: Q96PH6(Tdark)
UniProt: Q96PH6 A0A384MTK2
Position
20q11.21
AA seq 123 aa
MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNE
DHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVH
HSS
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaaactcctgctgctggctcttcctatgcttgtgctcctaccccaagtgatcccagcc
tatagtggtgaaaaaaaatgctggaacagatcagggcactgcaggaaacaatgcaaagat
ggagaagcagtgaaagatacatgcaaaaatcttcgagcttgctgcattccatccaatgaa
gaccacaggcgagttcctgcgacatctcccacacccttgagtgactcaacaccaggaatt
attgatgatattttaacagtaaggttcacgacagactactttgaagtaagcagcaagaaa
gatatggttgaagagtctgaggcgggaaggggaactgagacctctcttccaaatgttcac
catagctcatga

DBGET integrated database retrieval system