KEGG   Homo sapiens (human): 1174
Entry
1174              CDS       T01001                                 

Gene name
AP1S1, AP19, CLAPS1, EKV3, MEDNIK, SIGMA1A
Definition
(RefSeq) adaptor related protein complex 1 subunit sigma 1
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Disease
H02220  MEDNIK syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1174 (AP1S1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1174 (AP1S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1174 (AP1S1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    1174 (AP1S1)
SSDB
Motif
Pfam: Clat_adaptor_s DEK_C CNOT1_HEAT
Other DBs
NCBI-GeneID: 1174
NCBI-ProteinID: NP_001274
OMIM: 603531
HGNC: 559
Ensembl: ENSG00000106367
Vega: OTTHUMG00000157103
Pharos: P61966(Tbio)
UniProt: P61966 A0A024QYT6
Structure
PDB: 
4P6Z

Position
7q22.1
AA seq 158 aa
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYK
RYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
GDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatgcggttcatgctattattcagccggcagggaaaactgcggctgcaaaaatggtac
ctggccacttcggacaaggaacggaagaagatggtgcgcgagctcatgcaggttgtcctg
gctcgaaagcccaagatgtgcagcttcctggagtggagggacctcaaagttgtctataag
agatatgccagcctctacttctgctgcgccatcgagggccaagacaatgagctcatcaca
ctggagctgatccaccgatacgtggagctcttagacaaatactttggcagtgtgtgcgag
ctggacatcatcttcaactttgagaaggcctacttcatcctggatgagtttttgatgggg
ggggatgtccaggacacctccaagaagagtgtgctgaaagccatcgagcaggctgaccta
ctgcaagaggaggatgagtcgccacggagtgtgctggaggagatgggtttggcatag

DBGET integrated database retrieval system