KEGG   Homo sapiens (human): 1178Help
Entry
1178              CDS       T01001                                 

Gene name
CLC, GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN
Definition
(RefSeq) Charcot-Leyden crystal galectin
  KO
K13334  eosinophil lysophospholipase (galectin-10) [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     1178 (CLC)
Lectins [BR:hsa04091]
 S-type lectins (Galectins)
  1178 (CLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 1178
NCBI-ProteinID: NP_001819
OMIM: 153310
HGNC: 2014
Ensembl: ENSG00000105205
Vega: OTTHUMG00000183144
Pharos: Q05315(Tbio)
UniProt: Q05315
Structure
PDB: 

Position
19q13.2
AA seq 142 aa AA seqDB search
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGR
RVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEA
VKMVQVWRDISLTKFNVSYLKR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctacccgtgccatacacagaggctgcctctttgtctactggttctactgtg
acaatcaaagggcgaccacttgcctgtttcttgaatgaaccatatctgcaggtggatttc
cacactgagatgaaggaggaatcagacattgtcttccatttccaagtgtgctttggtcgt
cgtgtggtcatgaacagccgtgagtatggggcctggaagcagcaggtggaatccaagaat
atgccctttcaggatggccaagaatttgaactgagcatctcagtgctgccagataagtac
caggtaatggtcaatggccaatcctcttacacctttgaccatagaatcaagcctgaggct
gtgaagatggtgcaagtgtggagagatatctccctgaccaaatttaatgtcagctattta
aagagataa

DBGET integrated database retrieval system