KEGG   Homo sapiens (human): 1179Help
Entry
1179              CDS       T01001                                 

Gene name
CLCA1, CACC, CACC1, CLCRG1, CaCC-1, GOB5, hCLCA1, hCaCC-1
Definition
(RefSeq) chloride channel accessory 1
  KO
K05027  calcium-activated chloride channel regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04924  Renin secretion
hsa04972  Pancreatic secretion
Drug target
Niflumic acid: D08275
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1179 (CLCA1)
  09154 Digestive system
   04972 Pancreatic secretion
    1179 (CLCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1179 (CLCA1)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   1179 (CLCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLCA VWA_2 VWA VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 1179
NCBI-ProteinID: NP_001276
OMIM: 603906
HGNC: 2015
Ensembl: ENSG00000016490
Vega: OTTHUMG00000010254
Pharos: A8K7I4(Tbio)
UniProt: A8K7I4
Position
1p22.3
AA seq 914 aa AA seqDB search
MGPFKSSVFILILHLLEGALSNSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQA
SLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTE
QMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNG
RIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFA
QHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLL
QIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELI
QINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISG
CFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNG
AVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQG
GFVVDKNTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKD
TSKFPSPLVVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSR
YFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDD
VQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDY
DHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDL
FIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILK
IMWKWIGELQLSIA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggggccatttaagagttctgtgttcatcttgattcttcaccttctagaaggggccctg
agtaattcactcattcagctgaacaacaatggctatgaaggcattgtcgttgcaatcgac
cccaatgtgccagaagatgaaacactcattcaacaaataaaggacatggtgacccaggca
tctctgtatctgtttgaagctacaggaaagcgattttatttcaaaaatgttgccattttg
attcctgaaacatggaagacaaaggctgactatgtgagaccaaaacttgagacctacaaa
aatgctgatgttctggttgctgagtctactcctccaggtaatgatgaaccctacactgag
cagatgggcaactgtggagagaagggtgaaaggatccacctcactcctgatttcattgca
ggaaaaaagttagctgaatatggaccacaaggtagggcatttgtccatgagtgggctcat
ctacgatggggagtatttgacgagtacaataatgatgagaaattctacttatccaatgga
agaatacaagcagtaagatgttcagcaggtattactggtacaaatgtagtaaagaagtgt
cagggaggcagctgttacaccaaaagatgcacattcaataaagtaacaggactctatgaa
aaaggatgtgagtttgttctccaatcccgccagacggagaaggcttctataatgtttgca
caacatgttgattctatagttgaattctgtacagaacaaaaccacaacaaagaagctcca
aacaagcaaaatcaaaaatgcaatctccgaagcacatgggaagtgatccgtgattctgag
gactttaagaaaaccactcctatgacaacacagccaccaaatcccaccttctcattgctg
cagattggacaaagaattgtgtgtttagtccttgacaaatctggaagcatggcgactggt
aaccgcctcaatcgactgaatcaagcaggccagcttttcctgctgcagacagttgagctg
gggtcctgggttgggatggtgacatttgacagtgctgcccatgtacaaaatgaactcata
cagataaacagtggcagtgacagggacacactcgccaaaagattacctgcagcagcttca
ggagggacgtccatctgcagcgggcttcgatcggcatttactgtgattaggaagaaatat
ccaactgatggatctgaaattgtgctgctgacggatggggaagacaacactataagtggg
tgctttaacgaggtcaaacaaagtggtgccatcatccacacagtcgctttggggccctct
gcagctcaagaactagaggagctgtccaaaatgacaggaggtttacagacatatgcttca
gatcaagttcagaacaatggcctcattgatgcttttggggccctttcatcaggaaatgga
gctgtctctcagcgctccatccagcttgagagtaagggattaaccctccagaacagccag
tggatgaatggcacagtgatcgtggacagcaccgtgggaaaggacactttgtttcttatc
acctggacaatgcagcctccccaaatccttctctgggatcccagtggacagaagcaaggt
ggctttgtagtggacaaaaacaccaaaatggcctacctccaaatcccaggcattgctaag
gttggcacttggaaatacagtctgcaagcaagctcacaaaccttgaccctgactgtcacg
tcccgtgcgtccaatgctaccctgcctccaattacagtgacttccaaaacgaacaaggac
accagcaaattccccagccctctggtagtttatgcaaatattcgccaaggagcctcccca
attctcagggccagtgtcacagccctgattgaatcagtgaatggaaaaacagttaccttg
gaactactggataatggagcaggtgctgatgctactaaggatgacggtgtctactcaagg
tatttcacaacttatgacacgaatggtagatacagtgtaaaagtgcgggctctgggagga
gttaacgcagccagacggagagtgataccccagcagagtggagcactgtacatacctggc
tggattgagaatgatgaaatacaatggaatccaccaagacctgaaattaataaggatgat
gttcaacacaagcaagtgtgtttcagcagaacatcctcgggaggctcatttgtggcttct
gatgtcccaaatgctcccatacctgatctcttcccacctggccaaatcaccgacctgaag
gcggaaattcacgggggcagtctcattaatctgacttggacagctcctggggatgattat
gaccatggaacagctcacaagtatatcattcgaataagtacaagtattcttgatctcaga
gacaagttcaatgaatctcttcaagtgaatactactgctctcatcccaaaggaagccaac
tctgaggaagtctttttgtttaaaccagaaaacattacttttgaaaatggcacagatctt
ttcattgctattcaggctgttgataaggtcgatctgaaatcagaaatatccaacattgca
cgagtatctttgtttattcctccacagactccgccagagacacctagtcctgatgaaacg
tctgctccttgtcctaatattcatatcaacagcaccattcctggcattcacattttaaaa
attatgtggaagtggataggagaactgcagctgtcaatagcctag

DBGET integrated database retrieval system