KEGG   Homo sapiens (human): 1182Help
Entry
1182              CDS       T01001                                 

Gene name
CLCN3, CLC3, ClC-3
Definition
(RefSeq) chloride voltage-gated channel 3
  KO
K05012  chloride channel 3/4/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1182 (CLCN3)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel (CLC)
   1182 (CLCN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Voltage_CLC CBS
Motif
Other DBs
NCBI-GeneID: 1182
NCBI-ProteinID: NP_001820
OMIM: 600580
HGNC: 2021
Ensembl: ENSG00000109572
Vega: OTTHUMG00000160973
Pharos: P51790(Tbio)
UniProt: P51790
Position
4q33
AA seq 818 aa AA seqDB search
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMT
NGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTK
SLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETT
FEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSG
IPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLF
PKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAA
FVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNA
SKIVDDIPDRPAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRI
VGIAVEQLAYYHHDWFIFKEWCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFEL
TGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRP
RRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESAR
KKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGL
RQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgagcagctgttccatagaggctactatagaaacagctacaacagtataaca
agtgcaagtagtgatgaggaacttttagatggagcaggtgttattatggactttcaaaca
tctgaagatgacaatttattagatggtgacactgcagttggaactcattatacaatgaca
aatggaggcagcattaacagttctacacatttactggatcttttggatgaaccaattcca
ggtgttggtacatatgatgatttccatactattgattgggtgcgagaaaaatgtaaagac
agagaaaggcatagacggatcaacagcaaaaagaaagaatcagcatgggaaatgacaaaa
agtttgtatgatgcgtggtcaggatggctagtagtaacactaacaggattggcatcaggg
gcactggccggattaatagacattgctgccgattggatgactgacctaaaggagggcatt
tgccttagtgcgttgtggtacaaccacgaacagtgctgttggggatctaatgaaacaaca
tttgaagagagggataaatgtccacagtggaaaacatgggcagaattaatcataggtcaa
gcagagggtcctggttcttatatcatgaactacataatgtacatcttctgggccttgagt
tttgcctttcttgcagtttccctggtaaaggtatttgctccatatgcctgtggctctgga
attccagagattaaaactattttaagtggattcatcatcagaggttacttgggaaaatgg
actttaatgattaaaaccatcacattagtcctggctgtggcatcaggtttgagtttagga
aaagaaggtcccctggtacatgttgcctgttgctgcggaaatatcttttcctacctcttt
ccaaagtatagcacaaacgaagctaaaaaaagggaggtgctatcagctgcctcagctgca
ggggtttctgtagcttttggtgcaccaattggaggagttctttttagcctggaagaggtt
agctattattttcctctcaaaactttatggagatcattttttgctgctttagtggctgca
tttgttttgaggtccatcaatccatttggtaacagccgtctggtccttttttatgtggag
tatcatacaccatggtacctttttgaactgtttccttttattcttctaggggtatttgga
gggctttggggagcctttttcattagggcaaatattgcctggtgtcgtcgacgcaagtcc
acgaaatttggaaagtatcccgttctggaagtcattattgttgcagccattactgctgtg
atagccttccctaatccatacactaggctaaacaccagtgaactgatcaaagagcttttt
acagactgtggtcccctggaatcctcttctctttgtgactacagaaatgacatgaatgcc
agtaaaattgtcgatgacattcctgatcgtccagcaggcattggagtatattcagctata
tggcagttatgcctggcactcatatttaaaatcataatgacagtattcacttttggcatc
aaggttccatcaggcttgttcatccccagcatggccattggagcgatcgcaggaaggatt
gtggggattgcggtggagcagcttgcctactatcaccacgactggtttatctttaaggag
tggtgtgaggtcggggctgattgcattacacctggcctttatgccatggttggtgctgct
gcatgcttaggtggtgtgacaagaatgactgtctccctggtggttattgtttttgagctt
actggaggcttggaatatattgttccccttatggctgcagtcatgaccagtaaatgggtt
ggagatgcctttggcagggaaggcatttatgaagcacacatccgattaaatggataccct
ttcttggatgcaaaagaagaattcactcataccaccctggctgctgacgttatgagacct
cgaaggaatgatcctcccttagctgtcctgacacaggacaatatgacagtggatgatata
gaaaacatgattaatgaaaccagctacaatggatttcctgtcataatgtcaaaagaatct
cagagattagtgggatttgccctcagaagagacctgacaattgcaatagaaagtgccagg
aaaaaacaagaaggtatcgttggcagttctcgggtgtgttttgcacagcacaccccatct
cttccagcagaaagtcctcggccattgaagcttcgaagcattcttgacatgagccctttt
acagtgacagaccacaccccaatggagatcgtggtggatattttccgaaagctgggactg
aggcagtgccttgtaactcacaatgggcgcctccttggcattataacaaaaaaagatatc
ctccggcatatggcccagacggcaaaccaagaccccgcttcaataatgttcaactga

DBGET integrated database retrieval system