KEGG   Homo sapiens (human): 118424
Entry
118424            CDS       T01001                                 

Gene name
UBE2J2, NCUBE-2, NCUBE2, PRO2121
Definition
(RefSeq) ubiquitin conjugating enzyme E2 J2
  KO
K04554  ubiquitin-conjugating enzyme E2 J2 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118424 (UBE2J2)
   04120 Ubiquitin mediated proteolysis
    118424 (UBE2J2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    118424 (UBE2J2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    118424 (UBE2J2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     118424 (UBE2J2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   118424 (UBE2J2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 118424
NCBI-ProteinID: NP_477515
HGNC: 19268
Ensembl: ENSG00000160087
Vega: OTTHUMG00000001911
Pharos: Q8N2K1(Tbio)
UniProt: Q8N2K1 A0A024R075
Structure
PDB: 
2F4W

Position
1p36.33
AA seq 259 aa
MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcagcaccagcagtaagagggctccgaccacggcaacccagaggctgaagcaggac
taccttcgcattaagaaagacccggtgccttacatctgtgccgagcccctcccttcgaat
attctcgagtggcactatgtcgtccgaggcccagagatgaccccttatgaaggtggctat
tatcatggaaaactaatttttcccagagaatttcctttcaaacctcccagtatctatatg
atcactcccaacgggaggtttaagtgcaacaccaggctgtgtctttctatcacggatttc
cacccggacacgtggaacccggcctggtctgtctccaccatcctgactgggctcctgagc
ttcatggtggagaagggccccaccctgggcagtatagagacgtcggacttcacgaaaaga
caactggcagtgcagagtttagcatttaatttgaaagataaagtcttttgtgaattattt
cctgaagtcgtggaggagattaaacaaaaacagaaagcacaagacgaactcagtagcaga
ccccagactctccccttgccagacgtggttccagacggggagacgcacctcgtccagaac
gggattcagctgctcaacgggcatgcgccgggggccgtcccaaacctcgcagggctccag
caggccaaccggcaccacggactcctgggtggcgccctggcgaacttgtttgtgatagtt
gggtttgcagcctttgcttacacggtcaagtacgtgctgaggagcatcgcgcaggagtga

KEGG   Homo sapiens (human): 51465
Entry
51465             CDS       T01001                                 

Gene name
UBE2J1, CGI-76, HSPC153, HSPC205, HSU93243, NCUBE-1, NCUBE1, UBC6, UBC6E, Ubc6p
Definition
(RefSeq) ubiquitin conjugating enzyme E2 J1
  KO
K10578  ubiquitin-conjugating enzyme E2 J1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51465 (UBE2J1)
   04120 Ubiquitin mediated proteolysis
    51465 (UBE2J1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    51465 (UBE2J1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51465 (UBE2J1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     51465 (UBE2J1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   51465 (UBE2J1)
SSDB
Motif
Pfam: UQ_con RWD ATPase-cat_bd
Other DBs
NCBI-GeneID: 51465
NCBI-ProteinID: NP_057105
OMIM: 616175
HGNC: 17598
Ensembl: ENSG00000198833
Vega: OTTHUMG00000016337
Pharos: Q9Y385(Tbio)
UniProt: Q9Y385
Position
6q15
AA seq 318 aa
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELA
RQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQP
TQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
LIFRRIYLANEYIFDFEL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggagacccgctacaacctgaagagtccggctgttaaacgtttaatgaaagaagcggca
gaattgaaagatccaacagatcattaccatgcgcagcctttagaggataacctttttgaa
tggcacttcacggttagagggcccccagactccgattttgatggaggagtttatcacggg
cggatagtactgccaccagagtatcccatgaaaccaccaagcattattctcctaacggct
aatggtcgatttgaagtgggcaagaaaatctgtttgagcatctcaggccatcatcctgaa
acttggcagccttcgtggagtataaggacagcattattagccatcattgggtttatgcca
acaaaaggagagggagccataggttctctagattacactcctgaggaaagaagagcactt
gccaaaaaatcacaagatttctgttgtgaaggatgtggctctgccatgaaggatgtcctg
ttgcctttaaaatctggaagcgattcaagccaagctgaccaagaagccaaagaactggct
aggcaaataagctttaaggcagaagtcaattcatctggaaagactatctctgagtcagac
ttaaaccactctttttcactaactgatttacaagatgatatacctacaacattccagggt
gctacggccagtacatcgtacggactccagaattcctcagcagcatcctttcatcaacct
acccaacctgtagctaagaatacctccatgagccctcgacagcgccgggcccagcagcag
agtcagagaaggttgtctacttcaccagatgtaatccagggccaccagccaagagacaac
cacactgatcatggtgggtcagctgtactgattgtcatcctgactttggcattggcagct
cttatattccgacgaatatatctggcaaacgaatacatatttgactttgagttataa

KEGG   Homo sapiens (human): 7326
Entry
7326              CDS       T01001                                 

Gene name
UBE2G1, E217K, UBC7, UBE2G
Definition
(RefSeq) ubiquitin conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7326 (UBE2G1)
   04120 Ubiquitin mediated proteolysis
    7326 (UBE2G1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7326 (UBE2G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7326 (UBE2G1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7326 (UBE2G1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7326 (UBE2G1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 7326
NCBI-ProteinID: NP_003333
OMIM: 601569
HGNC: 12482
Ensembl: ENSG00000132388
Vega: OTTHUMG00000177826
Pharos: P62253(Tbio)
UniProt: P62253
Structure
PDB: 
2AWF 6D68

Position
17p13.2
AA seq 170 aa
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagctgcagtcggcactgctactgcgaagacagctggcagaactcaacaaaaat
ccagtggaaggcttttctgcaggtttaatagatgacaatgatctctaccgatgggaagtc
cttattattggccctccagatacactttatgaaggtggtgtttttaaggctcatcttact
ttcccaaaagattatcccctccgacctcctaaaatgaaattcattacagaaatctggcac
ccaaatgttgataaaaatggtgatgtgtgcatttctattcttcatgagcctggggaagat
aagtatggttatgaaaagccagaggaacgctggctccctatccacactgtggaaaccatc
atgattagtgtcatttctatgctggcagaccctaatggagactcacctgctaatgttgat
gctgcgaaagaatggagggaagatagaaatggagaatttaaaagaaaagttgcccgctgt
gtaagaaaaagccaagagactgcttttgagtga

KEGG   Homo sapiens (human): 7327
Entry
7327              CDS       T01001                                 

Gene name
UBE2G2, UBC7
Definition
(RefSeq) ubiquitin conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7327 (UBE2G2)
   04120 Ubiquitin mediated proteolysis
    7327 (UBE2G2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7327 (UBE2G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7327 (UBE2G2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7327 (UBE2G2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7327 (UBE2G2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 7327
NCBI-ProteinID: NP_003334
OMIM: 603124
HGNC: 12483
Ensembl: ENSG00000184787
Vega: OTTHUMG00000089179
Pharos: P60604(Tbio)
UniProt: P60604
Structure
PDB: 
3H8K 4LAD 2CYX 2LXP 2KLY

Position
21q22.3
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggggaccgcgctcaagaggctgatggccgagtacaaacaattaacactgaatcct
ccggaaggaattgtagcaggccccatgaatgaagagaacttttttgaatgggaggcattg
atcatgggcccagaagacacctgctttgagtttggtgtttttcctgccatcctgagtttc
ccacttgattacccgttaagtcccccaaagatgagatttacctgtgagatgtttcatccc
aacatctaccctgatgggagagtctgcatttccatcctccacgcgccaggcgatgacccc
atgggctacgagagcagcgcggagcggtggagtcctgtgcagagtgtggagaagatcctg
ctgtcggtggtgagcatgctggcagagcccaatgacgaaagtggagctaacgtggatgcg
tccaaaatgtggcgcgatgaccgggagcagttctataagattgccaagcagatcgtccag
aagtctctgggactgtga

DBGET integrated database retrieval system