KEGG   Homo sapiens (human): 118427
Entry
118427            CDS       T01001                                 
Symbol
OLFM3, NOE3, NOELIN3, OPTIMEDIN
Name
(RefSeq) olfactomedin 3
  KO
K25446  noelin-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    118427 (OLFM3)
SSDB
Motif
Pfam: OLF Noelin-1 Dynactin_p22 Helo_like_N
Other DBs
NCBI-GeneID: 118427
NCBI-ProteinID: NP_001275750
OMIM: 607567
HGNC: 17990
Ensembl: ENSG00000118733
Pharos: Q96PB7(Tbio)
UniProt: Q96PB7 Q6IMJ0 B3KTG9
Position
1:complement(101802560..101996926)
AA seq 478 aa
MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTLTQISPKEGWQVYSSAQD
PDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ
MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNL
SAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGA
WMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
SLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagtcctccactgctgaagcttggcgctgtgcttagtaccatggcaatgatctcaaac
tggatgtcccaaactctcccatccttggtgggactgaacaccacgaggctgtcgactccg
gataccttaactcagattagtcctaaagaagggtggcaggtgtacagctcagctcaggat
cctgatgggcggtgcatttgcacagttgttgctccagaacaaaacctgtgttcccgggat
gccaaaagcaggcaacttcgccaactactggaaaaggttcagaacatgtcccagtctatt
gaagtcttaaacttgagaactcagagagatttccaatatgttttaaaaatggaaacccaa
atgaaagggctgaaggcaaaatttcggcagattgaagatgatcgaaagacacttatgacc
aagcattttcaggagttgaaagagaaaatggacgagctcctgcctttgatccccgtgctg
gaacagtacaaaacagatgctaagttaatcacccagttcaaggaggaaataaggaatctg
tctgctgtcctcactggtattcaggaggaaattggtgcctatgactacgaggaactacac
caaagagtgctgagcttggaaacaagacttcgtgactgcatgaaaaagctaacatgtggc
aaactgatgaaaatcacaggcccagttacagtcaagacatctggaacccgatttggtgct
tggatgacagaccctttagcatctgagaaaaacaacagagtctggtacatggacagttat
actaacaataaaattgttcgtgaatacaaatcaattgcagactttgtcagtggggctgaa
tcaaggacatacaaccttcctttcaagtgggcaggaactaaccatgttgtctacaatggc
tcactctattttaacaagtatcagagtaatatcatcatcaaatacagctttgatatgggg
agagtgcttgcccaacgaagcctggagtatgctggttttcataatgtttacccctacaca
tggggtggattctctgacatcgacctaatggctgatgaaatcgggctgtgggctgtgtat
gcaactaaccagaatgcaggcaatattgtcatcagccaacttaaccaagataccttggag
gtgatgaagagctggagcactggctaccccaagagaagtgcaggggaatctttcatgatc
tgtgggacactgtatgtcaccaactcccacttaactggagccaaggtgtattattcctat
tccaccaaaacctccacatatgagtacacagacattcccttccataaccaatactttcac
atatccatgcttgactacaatgcaagagatcgagctctctatgcctggaacaatggccac
caggtgctgttcaatgtcacccttttccatatcatcaagacagaggatgacacatag

DBGET integrated database retrieval system