KEGG   Homo sapiens (human): 118460Help
Entry
118460            CDS       T01001                                 

Gene name
EXOSC6, EAP4, MTR3, Mtr3p, hMtr3p, p11
Definition
(RefSeq) exosome component 6
  KO
K12587  exosome complex component MTR3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Module
hsa_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    118460 (EXOSC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    118460 (EXOSC6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     118460 (EXOSC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH
Motif
Other DBs
NCBI-GeneID: 118460
NCBI-ProteinID: NP_478126
OMIM: 606490
HGNC: 19055
Ensembl: ENSG00000223496
Vega: OTTHUMG00000137578
Pharos: Q5RKV6(Tdark)
UniProt: Q5RKV6
Structure
PDB: 

Position
16q22.1
AA seq 272 aa AA seqDB search
MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGT
KVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEER
ELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLV
VGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEA
VRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggatcaccgccgcatccgcggccctgaagaatcgcagccgccgcagctgtac
gcggccgacgaggaggaggcgcccggcacccgcgacccaacgcggctacggcccgtgtac
gcgcgcgccgggctgctgagccaggccaagggctcggcctacctggaggcgggaggcacc
aaggtgctgtgtgccgtgtcgggcccgcgacaggccgagggcggcgagcgcggcggcggc
ccggccggagcaggcggcgaggccccggccgcgctgcgcggtcgcctgctctgcgacttc
cgccgcgcacccttcgcgggccgccggcgccgcgctcccccgggcggctgcgaggagcgt
gagctggcgctggcgctgcaggaggcgctggagccggctgtgcgcctgggccgctacccg
cgcgcgcagctcgaggtgtcggcgctgctgctggaggacggtggctcggccctggccgcc
gcgctcaccgccgccgcgctcgccctggccgacgcgggcgtggagatgtacgacctggtg
gtgggctgcggcctcagcctcgcgccggggcccgcgcccacctggctcctggaccccacg
cggctcgaggaagagcgcgccgccgccggcctcaccgtggcgctcatgcctgtgctgaat
caggtggccgggctgctgggcagcggcgagggcggcctgacagagagctgggcggaggcc
gtacgcctgggcctcgagggctgccagcgcctctaccccgtgctgcagcagagcctggtg
cgggccgcccgccgcaggggcgccgccgcccagccctga

DBGET integrated database retrieval system