KEGG   Homo sapiens (human): 118490
Entry
118490            CDS       T01001                                 

Gene name
MSS51, ZMYND17
Definition
(RefSeq) MSS51 mitochondrial translational activator
  KO
K17656  mitochondrial splicing suppressor protein 51
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    118490 (MSS51)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    118490 (MSS51)
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    118490 (MSS51)
SSDB
Motif
Pfam: zf-MYND zf-Mss51
Other DBs
NCBI-GeneID: 118490
NCBI-ProteinID: NP_001019764
OMIM: 614773
HGNC: 21000
Ensembl: ENSG00000166343
Vega: OTTHUMG00000018464
Pharos: Q4VC12(Tbio)
UniProt: Q4VC12
Position
10q22.2
AA seq 460 aa
MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQL
ILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKV
LRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWP
PEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVL
SRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVM
VGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHS
SPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAFGSNPFMSLKPE
QVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggctccacggtcccggcgacgaaggcacaagaaacctccctcatcagtggctcccatc
atcatggccccaaccacaattgtgacccctgtgcctctgaccccctcaaaacctggccct
agcattgacacacttggcttcttctccttggatgataatgttcctggcctatcgcagctg
atccttcaaaagctgaacatgaaaagctatgaagaatataagttggtggtagatgggggt
acccccgtatcaggctttggatttcgatgtcctcaagaaatgttccagaggatggaagac
acatttcgattctgtgctcactgtagagcactccctagtgggctttcagactccaaggtt
ctccggcactgtaagaggtgcagaaatgtctattactgtggtccagagtgccagaagtca
gactggcccgcacacaggagggtttgtcaagagcttcgtcttgtggctgtggaccgtctc
atggaatggcttctggtcacaggtgattttgttctaccctcaggaccttggccatggcca
cctgaagctgtacaggactgggactcctggttttctatgaaggggttacacctagatgct
acattggatgctgtgctagttagtcatgctgtgaccaccttatgggccagtgtaggacgg
ccaaggccagacccggatgtcctgcagggatctttgaagcggctgctgacagatgtcctg
tcacggcccttgactctaggcctaggacttagggccttggggatagatgttaggaggact
gggggaagcacagtgcatgtggttggtgcttcccatgtggagacatttcttactcgccca
ggggactatgatgagcttggttacatgtttcctgggcaccttggactccgtgtggtcatg
gtgggtgtagatgtagctactggcttttcacagagcacctcaacttcacccctggaacct
ggcacaattcagcttagtgcccacaggggcctctaccatgacttctgggaggagcaagta
gagaccgggcagacacaccatccagatttggtggcggcattccatccaggttttcattcc
tccccagacttgatggaggcttggctgcccaccctgctgctacttcgtgactataagatt
cctacattgattactgtttacagccatcaggagttggtatcctctttgcagattctggtg
gaactggatacacacatcactgcctttgggtctaatcctttcatgtccctcaaacctgaa
caggtctattccagtcccaacaagcagccagtatactgcagtgcatactatatcatgttt
cttggaagctcctgtcagctggataataggcaattagaagagaaagtggacggcgggatt
taa

DBGET integrated database retrieval system