KEGG   Homo sapiens (human): 1185
Entry
1185              CDS       T01001                                 

Gene name
CLCN6, CLC-6
Definition
(RefSeq) chloride voltage-gated channel 6
  KO
K05015  chloride channel 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1185 (CLCN6)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel (CLC)
   1185 (CLCN6)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 1185
NCBI-ProteinID: NP_001277
OMIM: 602726
HGNC: 2024
Ensembl: ENSG00000011021
Vega: OTTHUMG00000002299
Pharos: P51797(Tbio)
UniProt: P51797
Position
1p36.22
AA seq 869 aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDFFVRLFTQLKFGVVQTSVEEC
SQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEVKCYLNGVKVPGIVRLRTL
LCKVLGVLFSVAGGLFVEKEGPMIHSGSVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSSSQIGNDSFQLQVTED
VNSSIKTFFCPNDTYNDMATLFFNPQESAILQLFHQDGTFSPVTLALFFVLYFLLACWTY
GISVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTISL
TVILIESTNEITYGLPIMVTLMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLR
ASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK
KSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPAEKEDLLQQMLERRYTPYPNL
YPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAED
YPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNA
VGEIVGIITRHNLTYEFLQARLRQHYQTI
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggcggggtgcagggggtctctgtgctgctgctgcaggtggtgctgctgctgcggtgag
cgtgagacccgcacccccgaggagctgaccatccttggagaaacacaggaggaggaggat
gagattcttccaaggaaagactatgagagtttggattatgatcgctgtatcaatgaccct
tacctggaagttttggagaccatggataataagaaaggtcgaagatatgaggcggtgaag
tggatggtggtgtttgccattggagtctgcactggcctggtgggtctctttgtggacttt
tttgtgcgactcttcacccaactcaagttcggagtggtacagacatcggtggaggagtgc
agccagaaaggctgcctcgctctgtctctccttgaactcctgggttttaacctcaccttt
gtcttcctggcaagcctccttgttctcattgagccggtggcagcaggttccgggataccc
gaggtcaaatgctatctgaatggcgtaaaggtgccaggaatcgtccgtctccggaccctg
ctctgcaaggtccttggagtgctgttcagtgtggctggagggctcttcgtggagaaggaa
ggccccatgatccacagtggttcggtggtgggagctggcctccctcagtttcagagcatc
tccttacggaagatccagtttaacttcccctatttccgaagcgacagagacaagagagac
tttgtatcagcaggagcggctgctggagttgctgcagctttcggggcgccaatcgggggt
accttgttcagtctagaggagggttcgtccttctggaaccaagggctcacgtggaaagtg
ctcttttgttccatgtctgccaccttcaccctcaacttcttccgttctgggattcagttt
ggaagctggggttccttccagctccctggattgctgaactttggcgagtttaagtgctct
gactctgataaaaaatgtcatctctggacagctatggatttgggtttcttcgtcgtgatg
ggggtcattgggggcctcctgggagccacattcaactgtctgaacaagaggcttgcaaag
taccgtatgcgaaacgtgcacccgaaacctaagctcgtcagagtcttagagagcctcctt
gtgtctctggtaaccaccgtggtggtgtttgtggcctcgatggtgttaggagaatgccga
cagatgtcctcttcgagtcaaatcggtaatgactcattccagctccaggtcacagaagat
gtgaattcaagtatcaagacatttttttgtcccaatgatacctacaatgacatggccaca
ctcttcttcaacccgcaggagtctgccatcctccagctcttccaccaggatggtactttc
agccccgtcactctggccttgttcttcgttctctatttcttgcttgcatgttggacttac
ggcatttctgttccaagtggcctttttgtgccttctctgctgtgtggagctgcttttgga
cgtttagttgccaatgtcctaaaaagctacattggattgggccacatctattcggggacc
tttgccctgattggtgcagcggctttcttgggcggggtggtccgcatgaccatcagcctc
acggtcatcctgatcgagtccaccaatgagatcacctacgggctccccatcatggtcaca
ctgatggtggccaaatggacaggggactttttcaataagggcatttatgatatccacgtg
ggcctgcgaggcgtgccgcttctggaatgggagacagaggtggaaatggacaagctgaga
gccagcgacatcatggagcccaacctgacctacgtctacccgcacacccgcatccagtct
ctggtgagcatcctgcgcaccacggtccaccatgccttcccggtggtcacagagaaccgc
ggtaacgagaaggagttcatgaagggcaaccagctcatcagcaacaacatcaagttcaag
aaatccagcatcctcacccgggctggcgagcagcgcaaacggagccagtccatgaagtcc
tacccatccagcgagctacggaacatgtgtgatgagcacatcgcctctgaggagccagcc
gagaaggaggacctcctgcagcagatgctggaaaggagatacactccctaccccaaccta
taccctgaccagtccccaagtgaagactggaccatggaggagcggttccgccctctgacc
ttccacggcctgatccttcggtcgcagcttgtcaccctgcttgtccgaggagtttgttac
tctgaaagccagtcgagcgccagccagccgcgcctctcctatgccgagatggccgaggac
tacccgcggtaccccgacatccacgacctggacctgacgctgctcaacccgcgcatgatc
gtggatgtcaccccatacatgaacccttcgcctttcaccgtctcgcccaacacccacgtc
tcccaagtcttcaacctgttcagaacgatgggcctgcgccacctgcccgtggtgaacgct
gtgggagagatcgtggggatcatcacacggcacaacctcacctatgaatttctgcaggcc
cggctgaggcagcactaccagaccatctga

DBGET integrated database retrieval system