KEGG   Homo sapiens (human): 1187
Entry
1187              CDS       T01001                                 
Symbol
CLCNKA, CLCK1, ClC-K1, hClC-Ka
Name
(RefSeq) chloride voltage-gated channel Ka
  KO
K05017  chloride channel Ka
Organism
hsa  Homo sapiens (human)
Disease
H00239  Bartter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1187 (CLCNKA)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel (CLC)
   1187 (CLCNKA)
SSDB
Motif
Pfam: Voltage_CLC CBS Flavi_NS4A
Other DBs
NCBI-GeneID: 1187
NCBI-ProteinID: NP_004061
OMIM: 602024
HGNC: 2026
Ensembl: ENSG00000186510
Pharos: P51800(Tbio)
UniProt: P51800
Structure
Position
1:16022036..16034050
AA seq 687 aa
MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDWYFLMTLGVLM
ALVSYAMNFAIGCVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGG
SGIPELKTMLAGVILEDYLDIKNFGAKVVGLSCTLATGSTLFLGKVGPFVHLSVMIAAYL
GRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVRDYWRGF
FAATCGAFIFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGICGVLSCAYL
FCQRTFLSFIKTNRYSSKLLATSKPVYSALATLLLASITYPPGVGHFLASRLSMKQHLDS
LFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFILGAAIGRLLGEALAVAFPEGIVTGGVTNPIMPGGYALAGAAAFSGAVTH
TISTALLAFELTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTIIVKKLPYLPRILGRNI
GSHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLV
QALQAEPPSRAPGHQQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTS
RGRAVGCVSWVEMKKAISNLTNPPAPK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggaggagttggtggggctgcgtgagggcttctcaggggaccctgtgactctgcaggag
ctgtggggcccctgtccccacatccgccgagccatccaaggtggcctggagtggctaaag
cagaaggtgttccgcctgggagaagactggtacttcctgatgaccctcggggtgctcatg
gccctggtcagctatgccatgaactttgccatcgggtgtgtggtccgagcacaccagtgg
ctgtacagggagattggggacagccacctgctccggtatctttcctggactgtgtaccct
gtggccctcgtctctttctcctcaggcttctcccagagcatcacgccctcctctggaggt
tctggaatcccggagctgaagaccatgttggcgggtgtgatcttggaggactacctggat
atcaagaactttggggccaaggtggtgggcctctcctgcaccctggccaccggcagcacc
ctgttcctgggcaaagtgggccctttcgtgcacctgtctgtaatgatcgctgcctacctg
ggccgtgtgcgcaccacgaccatcggggagcctgagaacaagagcaagcaaaacgaaatg
ctggtggcagcggcggcagtgggcgtggccacagtctttgcagctcccttcagcggcgtc
ctgttcagcatcgaggtcatgtcttcccacttctctgtccgggattactggaggggcttc
tttgcggccacctgcggggccttcatattccggctcctggcagtcttcaacagcgagcag
gagaccatcacctccctctacaagaccagtttccgggtggacgttcccttcgacctgcct
gagatcttcttttttgtggcgctgggtggcatctgcggcgtcctgagctgtgcttacctc
ttctgtcagcgaaccttcctcagcttcatcaagaccaatcggtacagctccaaactgctg
gctactagcaagcctgtgtactccgctctggccaccttgcttctcgcctccatcacctac
ccgcctggtgtgggccacttcctagcttctcggctgtccatgaagcagcatctggactcg
ctgttcgacaaccactcctgggcgctgatgacccagaactccagcccaccctggcccgag
gagctcgacccccagcacctttggtgggaatggtaccacccgcggttcaccatctttggg
acccttgccttcttcctggttatgaagttctggatgctgattctggccaccaccatcccc
atgcctgccgggtacttcatgcccatctttatccttggagctgccatcgggcgcctcttg
ggagaggctcttgccgtcgccttccctgagggcattgtgactggaggggttaccaatccc
atcatgcccggggggtatgctctggcaggggctgcagccttctcaggggctgtgacccac
accatctccacggcgctgctggcctttgagctgaccggccagatagtgcatgcactgccc
gtgctgatggcggtgctggcagccaacgccattgcacagagctgccagccctccttctat
gatggcaccatcattgtcaagaagctgccatacctgccacggattctgggccgcaacatc
ggctcccaccatgtgagggtggagcacttcatgaaccacagcatcaccacactggccaag
gacacgccgctggaggaggtggtcaaggttgtgacctccacagacgtgaccgagtatccc
ctggtggagagcacagagtcccagatcctggtaggcatcgtgcagagggcccagctggtg
caggccctccaggctgagcctccttccagggctccaggacaccagcagtgtctccaggac
atcttggccaggggctgccccacggaaccagtgaccctgacgctattctcagagaccacc
ttgcaccaggcacaaaacctctttaagctgttgaaccttcagtccctcttcgtgacatcg
cggggcagagctgtgggctgcgtgtcctgggtggagatgaagaaagcaatttccaacctg
acaaatccgccagctccaaagtga

DBGET integrated database retrieval system