KEGG   Homo sapiens (human): 118932Help
Entry
118932            CDS       T01001                                 

Gene name
ANKRD22
Definition
(RefSeq) ankyrin repeat domain 22
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank Ank_2 Ank_4 Ank_5 Ank_3 DUF4181 UPF0542
Motif
Other DBs
NCBI-GeneID: 118932
NCBI-ProteinID: NP_653191
HGNC: 28321
Ensembl: ENSG00000152766
Vega: OTTHUMG00000018699
Pharos: Q5VYY1(Tdark)
UniProt: Q5VYY1
Position
10q23.31
AA seq 191 aa AA seqDB search
MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLL
RRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRM
LLDAGVEVNATDCYGCTALHYACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKF
SQIELMLRKAL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctatactctgagcccatctgccaagcagcctatcagaatgactttggacaa
gtgtggcggtgggtgaaagaagacagcagctatgccaacgttcaagatggctttaatgga
gacacgcccctgatctgtgcttgcaggcgagggcatgtgagaatcgtttccttcctttta
agaagaaatgctaatgtcaacctcaaaaaccagaaagagagaacctgcttgcattatgct
gtgaagaaaaaatttaccttcattgattatctactaattatcctcttaatgcctgttctg
cttattgggtatttcctcatggtatcaaagacaaagcagaatgaggctcttgtacgaatg
ctacttgatgctggcgtcgaagttaatgctacagattgttatggctgtaccgcattacat
tatgcctgtgaaatgaaaaaccagtctcttatccctctgctcttggaagcccgtgcagac
cccacaataaagaataagcatggtgagagctcactggatattgcacggagattaaaattt
tcccagattgaattaatgctaaggaaagcattgtaa

DBGET integrated database retrieval system