KEGG   Homo sapiens (human): 118987
Entry
118987            CDS       T01001                                 

Gene name
PDZD8, PDZK8
Definition
(RefSeq) PDZ domain containing 8
  KO
K24060   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PDZ_6 PDZ C1_1 PDZ_2 GRASP55_65
Other DBs
NCBI-GeneID: 118987
NCBI-ProteinID: NP_776152
OMIM: 614235
HGNC: 26974
Ensembl: ENSG00000165650
Vega: OTTHUMG00000019122
Pharos: Q8NEN9(Tbio)
UniProt: Q8NEN9
Position
10q25.3-q26.11
AA seq 1154 aa
MGLLLMILASAVLGSFLTLLAQFFLLYRRQPEPPADEAARAGEGFRYIKPVPGLLLREYL
YGGGRDEEPSGAAPEGGATPTAAPETPAPPTRETCYFLNATILFLFRELRDTALTRRWVT
KKIKVEFEELLQTKTAGRLLEGLSLRDVFLGETVPFIKTIRLVRPVVPSATGEPDGPEGE
ALPAACPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRLVFTRVPFTH
WFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPNYKIRFKPFFPYQT
LQGFEEDEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQ
RSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIG
GVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDNFGQLEENFLSSSCQSGYEE
EAAGLTVDTESRELDSEFEDLASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAISPV
LNRKLAVGSHPLPPKIQSKDGNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAKVP
LPSADAPNQAEPDVLVEKPEKVVPPPLVDKSAEKQAKNVDAIDDAAAPKQFLAKQEVAKD
VTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASCLFDIEACHRYLNIALWCRDP
FKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGF
NDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENK
HSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDR
TLKNLRLEGQETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPG
TDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIG
RDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDTRKKSLLSAALAKS
GERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYTDDTEEDLDNEISQLIDSQPF
SSISDDLFGPSESV
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggggctgctgctcatgatcctggcgtcggccgtgctgggttccttcctcacgctcctc
gcccagttcttcctgctgtaccgcagacagcccgagccgccggcggacgaggccgcccgc
gcgggcgagggcttccgctacatcaagccagtgccgggcctgctcctaagggagtacctt
tatggcggcggccgggatgaggagccctccggagcggcccctgagggcggcgcgaccccc
accgcggcccccgagacccccgccccgccgacgcgggagacttgctacttcctcaacgcc
accatcctattcctgttccgggagttgcgggacaccgcgctgacccgccgctgggtcacc
aagaagatcaaggtggagttcgaggagctgctgcagaccaagacggccgggcgcctgctg
gaggggctgagcctgcgggacgtgttcctgggcgagacggtgcccttcatcaagaccatc
cggctcgtgcggccagtcgtgccctcggccaccggggagcccgatggccctgaaggggag
gcgctgcccgccgcctgccccgaggagctggccttcgaggcggaggtggagtacaacggg
ggcttccacctggccatcgacgtggacctggtcttcggcaagtccgcctacttgtttgtc
aagctgtcccgcgtggtgggaaggctgcgcttggtctttacgcgcgtgcccttcacccac
tggttcttctccttcgtggaagacccgctgatcgacttcgaggtgcgctcccagtttgaa
gggcggcccatgccccagctcacctccatcatcgtcaaccagctcaagaagatcatcaag
cgcaagcacaccctaccgaattacaagatcaggtttaagccgttttttccataccagacc
ttgcaaggatttgaagaagatgaagagcatatccatatacaacaatgggcacttactgaa
ggccgtcttaaagttacgttgttagaatgtagcaggttactcatttttggatcctatgac
agagaggcaaatgttcattgcacacttgagttaagcagtagtgtttgggaagaaaaacag
aggagttctattaagacggttgaattaataaaaggaaatttacaaagtgttggacttaca
cttcgtcttgtccagtcaactgatgggtatgctgggcacgtcatcattgaaactgtggct
ccaaactcgcctgctgcaattgcagatcttcagcggggagatcgacttatcgccattgga
ggtgtgaaaatcacatcaacactgcaagtgttgaagcttatcaagcaggctggtgaccga
gtcctggtgtactatgaaaggcctgttggccagagtaatcaaggtgcagtgctgcaagat
aactttggccagttggaagaaaactttttgtcaagctcatgccaatcgggttatgaagag
gaagctgccgggttgacagtagatactgaaagtagagagctggattctgaatttgaagac
ttggcaagtgatgtcagagcacaaaatgagttcaaagatgaggcacaatcattaagtcat
agtcccaaacgtgttccaacaacactttctattaaaccccttggagctatatcaccagtt
ttaaaccgtaaattagctgtaggaagtcacccactaccaccgaaaattcagtccaaagat
ggaaataaacctccacccctaaaaacttctgagataacagacccagcacaagtgtcaaaa
ccaacccaaggatctgctttcaaaccacctgtgccaccacgaccacaagcgaaagttcct
ttgccttccgccgatgctccaaatcaggcagaaccagatgttctcgttgaaaagccagag
aaggtggtgccacctcctcttgtagataaatctgctgaaaagcaagcaaaaaatgtggat
gccatagacgatgcagctgcacctaagcaatttttagcaaagcaagaagtggccaaagat
gtcacttcagaaacttcctgccctactaaggacagttcggacgaccgtcaaacatgggaa
tcatcagaaattctttatcgtaataagctaggaaaatggacaagaaccagagcatcctgt
ttgtttgacatagaagcctgtcacaggtacttaaacattgcattgtggtgcagggatcct
ttcaagttgggaggtctcatctgtttggggcatgttagtttaaaacttgaagatgtggct
ttaggatgcctagctacatcaaacacggaatacctttccaaattgagactggaagccccc
tcacctaaggctatagtcactagaaccgcactacgcaatctgagtatgcaaaagggattc
aatgacaaattttgctatggtgacattactattcacttcaaatatttgaaagaaggagaa
tcagaccaccatgtagttactaacgtagaaaaagaaaaagaaccccatttggttgaagaa
gtttctgttctccctaaagaggagcaatttgttggacagatgggtttaacagaaaacaaa
cacagttttcaggatactcagttccagaacccaacatggtgtgactactgtaagaaaaaa
gtttggactaaagcagcttcccagtgtatgttttgtgcttatgtttgccataaaaaatgt
caagaaaagtgtctagctgagacttctgtttgtggagcaactgataggcgaatagacagg
acactgaaaaaccttaggctggaaggacaggaaaccctcttaggcctgcctcctcgtgtt
gatgctgaagctagcaagtcagtcaataaaacaacaggtttgacaaggcatattatcaat
actagttctcgtttattaaatttgcgtcaagtctctaaaactcgcctttctgaaccagga
accgatctcgtagaaccttcaccaaaacacacacccaacacgtcagacaacgaaggcagt
gacacggaggtctgtggtccaaacagtccttctaaacggggaaacagcacaggaataaag
ttagtgagaaaagagggtggtctggatgacagtgttttcattgcagttaaagaaattggt
cgtgatctgtacaggggcttgcctacagaggaaaggatccagaaactagagttcatgttg
gataagctacagaatgaaattgatcaggagttggaacacaataattcccttgttagagaa
gaaaaagagacaactgatacaaggaaaaaatcacttctttctgctgccttagctaaatca
ggtgaaaggctacaagctctaacacttcttatgattcactacagagcaggcattgaagat
atagaaactttagaaagtctgtctttagaccagcactccaaaaaaataagcaagtacaca
gatgatacagaagaagaccttgataatgaaataagccaactaatagactctcagccattc
agcagcatatcagatgacttatttggcccatccgagtctgtgtag

DBGET integrated database retrieval system