KEGG   Homo sapiens (human): 1192
Entry
1192              CDS       T01001                                 

Symbol
CLIC1, CL1C1, CLCNL1, G6, NCC27
Name
(RefSeq) chloride intracellular channel 1
  KO
K05021  chloride intracellular channel protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1192 (CLIC1)
   04040 Ion channels [BR:hsa04040]
    1192 (CLIC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1192 (CLIC1)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   1192 (CLIC1)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_N_4 GST_C_3
Other DBs
NCBI-GeneID: 1192
NCBI-ProteinID: NP_001274522
OMIM: 602872
HGNC: 2062
Ensembl: ENSG00000213719
Vega: OTTHUMG00000031103
Pharos: O00299(Tbio)
UniProt: O00299 Q5SRT3
Structure
PDB: 

Position
6p21.33
AA seq 241 aa
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atggctgaagaacaaccgcaggtcgaattgttcgtgaaggctggcagtgatggggccaag
attgggaactgcccattctcccagagactgttcatggtactgtggctcaagggagtcacc
ttcaatgttaccaccgttgacaccaaaaggcggaccgagacagtgcagaagctgtgccca
ggggggcagctcccattcctgctgtatggcactgaagtgcacacagacaccaacaagatt
gaggaatttctggaggcagtgctgtgccctcccaggtaccccaagctggcagctctgaac
cctgagtccaacacagctgggctggacatatttgccaaattttctgcctacatcaagaat
tcaaacccagcactcaatgacaatctggagaagggactcctgaaagccctgaaggtttta
gacaattacttaacatcccccctcccagaagaagtggatgaaaccagtgctgaagatgaa
ggtgtctctcagaggaagtttttggatggcaacgagctcaccctggctgactgcaacctg
ttgccaaagttacacatagtacaggtggtgtgtaagaagtaccggggattcaccatcccc
gaggccttccggggagtgcatcggtacttgagcaatgcctacgcccgggaagaattcgct
tccacctgtccagatgatgaggagatcgagctcgcctatgagcaagtggcaaaggccctc
aaataa

DBGET integrated database retrieval system