KEGG   Homo sapiens (human): 1193Help
Entry
1193              CDS       T01001                                 

Gene name
CLIC2, CLIC2b, MRXS32, XAP121
Definition
(RefSeq) chloride intracellular channel 2
  KO
K05022  chloride intracellular channel protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1193 (CLIC2)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   1193 (CLIC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 Glutaredoxin GST_C MKT1_C GST_N_4 zf-RING_7
Motif
Other DBs
NCBI-GeneID: 1193
NCBI-ProteinID: NP_001280
OMIM: 300138
HGNC: 2063
Ensembl: ENSG00000155962
Vega: OTTHUMG00000022660
Pharos: O15247(Tbio)
UniProt: O15247
Structure
PDB: 

Position
Xq28
AA seq 247 aa AA seqDB search
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE
LKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcctgcggcccggcactcaagtggaccctgagattgagctttttgtaaaggct
ggaagtgatggagagagtattggaaactgtcccttttgccaacgccttttcatgatcctc
tggcttaaaggagttaaatttaatgtgacaactgttgacatgaccagaaagcctgaagaa
ctaaaggacttagccccaggtaccaatcctccgttcctggtgtataacaaggagttgaaa
acagacttcattaaaattgaggagtttttagaacaaaccctggctcctccaaggtaccct
cacctgagtcccaagtacaaggagtcttttgatgtgggctgtaacctctttgccaagttt
tctgcatacattaagaatacacaaaaggaggcaaataagaattttgaaaaatctctgctc
aaagaattcaagcgtctggatgactacttaaacaccccacttctggatgaaattgatcca
gacagtgctgaggaacccccagtttccagaagactattcttggatggggaccagctaaca
ctggctgattgtagcttgttacccaagctgaacattattaaagttgctgccaagaaatat
cgtgactttgacattccagcagaattctcaggagtctggcgttatctccacaatgcctat
gcccgtgaagaatttacccacacgtgtcctgaagacaaagaaattgaaaatacttacgca
aatgtggctaaacagaagagttag

DBGET integrated database retrieval system