KEGG   Homo sapiens (human): 119391Help
Entry
119391            CDS       T01001                                 

Gene name
GSTO2, GSTO_2-2, bA127L20.1
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    119391 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    119391 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    119391 (GSTO2)
   00983 Drug metabolism - other enzymes
    119391 (GSTO2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    119391 (GSTO2)
   05204 Chemical carcinogenesis
    119391 (GSTO2)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    119391 (GSTO2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    119391 (GSTO2)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    119391 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    119391 (GSTO2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     119391 (GSTO2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   119391 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 119391
NCBI-ProteinID: NP_899062
OMIM: 612314
HGNC: 23064
Ensembl: ENSG00000065621
Vega: OTTHUMG00000019006
Pharos: Q9H4Y5(Tbio)
UniProt: Q9H4Y5
Structure
PDB: 

Position
10q25.1
AA seq 243 aa AA seqDB search
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgcccctattctcacaggacccgcctc
gtcctcaaggccaaagacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgt
caactgatctatgaatctgttattgcttgtgagtacctggatgatgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actaatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

DBGET integrated database retrieval system