KEGG   Homo sapiens (human): 119391Help
Entry
119391            CDS       T01001                                 

Gene name
GSTO2, GSTO_2-2, bA127L20.1
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    119391 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    119391 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    119391 (GSTO2)
   00983 Drug metabolism - other enzymes
    119391 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119391 (GSTO2)
   05204 Chemical carcinogenesis
    119391 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    119391 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    119391 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    119391 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    119391 (GSTO2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     119391 (GSTO2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   119391 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 119391
NCBI-ProteinID: NP_899062
OMIM: 612314
HGNC: 23064
Ensembl: ENSG00000065621
Vega: OTTHUMG00000019006
Pharos: Q9H4Y5(Tbio)
UniProt: Q9H4Y5
Structure
PDB: 

Position
10q25.1
AA seq 243 aa AA seqDB search
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgcccctattctcacaggacccgcctc
gtcctcaaggccaaagacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgt
caactgatctatgaatctgttattgcttgtgagtacctggatgatgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actaatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

KEGG   Homo sapiens (human): 221357Help
Entry
221357            CDS       T01001                                 

Gene name
GSTA5
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    221357 (GSTA5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    221357 (GSTA5)
   00982 Drug metabolism - cytochrome P450
    221357 (GSTA5)
   00983 Drug metabolism - other enzymes
    221357 (GSTA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    221357 (GSTA5)
   05204 Chemical carcinogenesis
    221357 (GSTA5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    221357 (GSTA5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    221357 (GSTA5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    221357 (GSTA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    221357 (GSTA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     221357 (GSTA5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   221357 (GSTA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 221357
NCBI-ProteinID: NP_714543
OMIM: 607605
HGNC: 19662
Ensembl: ENSG00000182793
Vega: OTTHUMG00000014857
Pharos: Q7RTV2(Tdark)
UniProt: Q7RTV2
Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAK
TALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatgcacggggcagtatggagtccattcgg
tggctcctggctgcagctggagtagagttggaagagaaatttctagaatctgcagaagat
ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatt
gacgggatgaagctggtgcagaccagagccattcttaactacattgccagcaaatacaac
ctttatgggaaagacatgaaggagagagccctgattgatatgtacacagaaggtatagta
gatttgactgaaatgatccttcttctgctcatatgtcaaccagaggaaagagatgccaag
actgccttggtcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccacagacaagactaccttgttggcaacaagctgagctgggctgacattcacctg
gtggaacttttctactacgtggaagagcttgactcgagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct
ggcagccagagaaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 27306Help
Entry
27306             CDS       T01001                                 

Gene name
HPGDS, GSTS, GSTS1, GSTS1-1, PGD2, PGDS
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    27306 (HPGDS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    27306 (HPGDS)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    27306 (HPGDS)
   00982 Drug metabolism - cytochrome P450
    27306 (HPGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    27306 (HPGDS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     27306 (HPGDS)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     27306 (HPGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_N_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 27306
NCBI-ProteinID: NP_055300
OMIM: 602598
HGNC: 17890
Ensembl: ENSG00000163106
Vega: OTTHUMG00000130974
Pharos: O60760(Tchem)
UniProt: O60760 A0A384P5J0
Structure
PDB: 

Position
4q22.3
AA seq 199 aa AA seqDB search
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactacaaactcacttattttaatatgagggggagagcagaaattattcgttac
atatttgcttatttggacatacagtatgaagaccacagaatagaacaagctgactggcct
gaaatcaaatcaactctcccatttggaaaaatccccattttggaagttgatggacttact
cttcaccagagcctagcaatagcaagatatttgaccaaaaacacagatttggctggaaac
acagaaatggaacaatgtcatgttgatgctattgtggacactctggatgatttcatgtca
tgttttccttgggcagagaaaaagcaagatgtgaaagagcagatgttcaatgagctgctc
acgtataatgcgcctcatcttatgcaagacttggacacatatttaggggggagagaatgg
cttattggtaactctgtaacttgggcagacttctactgggagatttgcagtaccacactt
ttggtctttaagcctgacctgttagacaaccatccaaggctggtgactttacggaagaaa
gtccaagccattcctgccgtcgctaactggataaaacgaaggccccaaaccaaactctag

KEGG   Homo sapiens (human): 2938Help
Entry
2938              CDS       T01001                                 

Gene name
GSTA1, GST-epsilon, GST2, GSTA1-1, GTH1
Definition
(RefSeq) glutathione S-transferase alpha 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2938 (GSTA1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2938 (GSTA1)
   00982 Drug metabolism - cytochrome P450
    2938 (GSTA1)
   00983 Drug metabolism - other enzymes
    2938 (GSTA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2938 (GSTA1)
   05204 Chemical carcinogenesis
    2938 (GSTA1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2938 (GSTA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2938 (GSTA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2938 (GSTA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2938 (GSTA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2938 (GSTA1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2938 (GSTA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2938
NCBI-ProteinID: NP_665683
OMIM: 138359
HGNC: 4626
Ensembl: ENSG00000243955
Vega: OTTHUMG00000014861
Pharos: P08263(Tchem)
UniProt: P08263 A0A140VJK4
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactacttcaatgcacggggcagaatggagtccacccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagagagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatcctccttctgcccgtatgtccacctgaggaaaaagatgccaag
cttgccttgatcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattcatctg
gtggaacttctctactacgtcgaggagcttgactccagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2939Help
Entry
2939              CDS       T01001                                 

Gene name
GSTA2, GST2, GSTA2-2, GTA2, GTH2
Definition
(RefSeq) glutathione S-transferase alpha 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2939 (GSTA2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2939 (GSTA2)
   00982 Drug metabolism - cytochrome P450
    2939 (GSTA2)
   00983 Drug metabolism - other enzymes
    2939 (GSTA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2939 (GSTA2)
   05204 Chemical carcinogenesis
    2939 (GSTA2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2939 (GSTA2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2939 (GSTA2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2939 (GSTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2939 (GSTA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2939 (GSTA2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2939 (GSTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 2939
NCBI-ProteinID: NP_000837
OMIM: 138360
HGNC: 4627
Ensembl: ENSG00000244067
Vega: OTTHUMG00000016263
Pharos: P09210(Tbio)
UniProt: P09210 A0A140VKE2 A8K987
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAK
LALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatatacggggcagaatggagtccatccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagaaagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatccttcttctgccctttagtcaacctgaggaacaagatgccaag
cttgccttgatccaagagaaaacaaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccacggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg
gtggaacttctctactacgtggaagagcttgactctagccttatttccagcttccctctg
ctgaaggccctgaaaaccagaatcagtaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaatcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2940Help
Entry
2940              CDS       T01001                                 

Gene name
GSTA3, GSTA3-3, GTA3
Definition
(RefSeq) glutathione S-transferase alpha 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2940 (GSTA3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2940 (GSTA3)
   00982 Drug metabolism - cytochrome P450
    2940 (GSTA3)
   00983 Drug metabolism - other enzymes
    2940 (GSTA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2940 (GSTA3)
   05204 Chemical carcinogenesis
    2940 (GSTA3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2940 (GSTA3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2940 (GSTA3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2940 (GSTA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2940 (GSTA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2940 (GSTA3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2940 (GSTA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C DUF3825 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2940
NCBI-ProteinID: NP_000838
OMIM: 605449
HGNC: 4628
Ensembl: ENSG00000174156
Vega: OTTHUMG00000014865
Pharos: Q16772(Tbio)
UniProt: Q16772
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaagcccaagcttcactacttcaatggacggggcagaatggagcccatccgg
tggctcttggctgcagctggagtggagtttgaagagaaatttataggatctgcagaagat
ttgggaaagttaagaaatgatgggagtttgatgttccagcaagtaccaatggttgagatt
gatgggatgaagttggtacagaccagagccattctcaactacattgccagcaaatacaac
ctctacgggaaagacataaaggagagagccctaattgatatgtatacagaaggtatggca
gatttgaatgaaatgatccttcttctgcccttatgtcgacctgaggaaaaagatgccaag
attgccttgatcaaagagaaaacaaaaagtcgctatttccctgccttcgaaaaagtgtta
cagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattagcctg
gtggaacttctctactatgtggaagagcttgactccagccttatctccaacttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctacagcct
ggcagcccaaggaagcctcccgcagatgcaaaagctttagaagaagccagaaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2941Help
Entry
2941              CDS       T01001                                 

Gene name
GSTA4, GSTA4-4, GTA4
Definition
(RefSeq) glutathione S-transferase alpha 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2941 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2941 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    2941 (GSTA4)
   00983 Drug metabolism - other enzymes
    2941 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2941 (GSTA4)
   05204 Chemical carcinogenesis
    2941 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2941 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2941 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2941 (GSTA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2941 (GSTA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2941 (GSTA4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2941 (GSTA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 CbeA_antitoxin GST_N_3
Motif
Other DBs
NCBI-GeneID: 2941
NCBI-ProteinID: NP_001503
OMIM: 605450
HGNC: 4629
Ensembl: ENSG00000170899
Vega: OTTHUMG00000014868
Pharos: O15217(Tbio)
UniProt: O15217 A0A024RD58
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaggcccaagctccactatcccaacggaagaggccggatggagtccgtgaga
tgggttttagctgccgccggagtcgagtttgatgaagaatttctggaaacaaaagaacag
ttgtacaagttgcaggatggtaaccacctgctgttccaacaagtgcccatggttgaaatt
gacgggatgaagttggtacagacccgaagcattctccactacatagcagacaagcacaat
ctctttggcaagaacctcaaggagagaaccctgattgacatgtacgtggaggggacactg
gatctgctggaactgcttatcatgcatcctttcttaaaaccagatgatcagcaaaaggaa
gtggttaacatggcccagaaggctataattagatactttcctgtgtttgaaaagatttta
aggggtcacggacaaagctttcttgttggtaatcagctgagccttgcagatgtgatttta
ctccaaaccattttagctctagaagagaaaattcctaatatcctgtctgcatttcctttc
ctccaggaatacacagtgaaactaagtaatatccctacaattaagagattccttgaacct
ggcagcaagaagaagcctccccctgatgaaatttatgtgagaaccgtctacaacatcttt
aggccataa

KEGG   Homo sapiens (human): 2944Help
Entry
2944              CDS       T01001                                 

Gene name
GSTM1, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Definition
(RefSeq) glutathione S-transferase mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2944 (GSTM1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2944 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    2944 (GSTM1)
   00983 Drug metabolism - other enzymes
    2944 (GSTM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2944 (GSTM1)
   05204 Chemical carcinogenesis
    2944 (GSTM1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2944 (GSTM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2944 (GSTM1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2944 (GSTM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2944 (GSTM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2944 (GSTM1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2944 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2944
NCBI-ProteinID: NP_000552
OMIM: 138350
HGNC: 4632
Ensembl: ENSG00000134184
Vega: OTTHUMG00000011635
Pharos: P09488(Tbio)
UniProt: P09488 X5DR03
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt
gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc
tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag

KEGG   Homo sapiens (human): 2946Help
Entry
2946              CDS       T01001                                 

Gene name
GSTM2, GST4, GSTM, GSTM2-2, GTHMUS
Definition
(RefSeq) glutathione S-transferase mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2946 (GSTM2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2946 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    2946 (GSTM2)
   00983 Drug metabolism - other enzymes
    2946 (GSTM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2946 (GSTM2)
   05204 Chemical carcinogenesis
    2946 (GSTM2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2946 (GSTM2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2946 (GSTM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2946 (GSTM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2946 (GSTM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2946 (GSTM2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2946 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3 Bromo_TP GST_N_2
Motif
Other DBs
NCBI-GeneID: 2946
NCBI-ProteinID: NP_000839
OMIM: 138380
HGNC: 4634
Ensembl: ENSG00000213366
Vega: OTTHUMG00000011638
Pharos: P28161(Tchem)
UniProt: P28161 A0A384P5E9 Q0D2I8
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccattccatccgcctgctc
ctggaatacacagactcaagctacgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcggtacatt
gcccgcaagcacaacctgtgcggggaatcagaaaaggagcagattcgcgaagacattttg
gagaaccagtttatggacagccgtatgcagctggccaaactctgctatgacccagatttt
gagaaactgaaaccagaatacctgcaggcactccctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtag

KEGG   Homo sapiens (human): 2947Help
Entry
2947              CDS       T01001                                 

Gene name
GSTM3, GST5, GSTB, GSTM3-3, GTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2947 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2947 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    2947 (GSTM3)
   00983 Drug metabolism - other enzymes
    2947 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2947 (GSTM3)
   05204 Chemical carcinogenesis
    2947 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2947 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2947 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2947 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2947 (GSTM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2947 (GSTM3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2947 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2947
NCBI-ProteinID: NP_000840
OMIM: 138390
HGNC: 4635
Ensembl: ENSG00000134202
Vega: OTTHUMG00000011640
Pharos: P21266(Tbio)
UniProt: P21266 Q6FGJ9
Structure
PDB: 

Position
1p13.3
AA seq 225 aa AA seqDB search
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgccggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttacagtctgatcagttctgcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

KEGG   Homo sapiens (human): 2948Help
Entry
2948              CDS       T01001                                 

Gene name
GSTM4, GSTM4-4, GTM4
Definition
(RefSeq) glutathione S-transferase mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2948 (GSTM4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2948 (GSTM4)
   00982 Drug metabolism - cytochrome P450
    2948 (GSTM4)
   00983 Drug metabolism - other enzymes
    2948 (GSTM4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2948 (GSTM4)
   05204 Chemical carcinogenesis
    2948 (GSTM4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2948 (GSTM4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2948 (GSTM4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2948 (GSTM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2948 (GSTM4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2948 (GSTM4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2948 (GSTM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 Bromo_TP
Motif
Other DBs
NCBI-GeneID: 2948
NCBI-ProteinID: NP_000841
OMIM: 138333
HGNC: 4636
Ensembl: ENSG00000168765
Vega: OTTHUMG00000011642
Pharos: Q03013(Tbio)
UniProt: Q03013 A0A140VKE3
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgacactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctacgaggaaaagaagtatacgatgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcctgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggctatggacgtctccaatcagctggccagagtctgctacagccctgacttt
gagaaactgaagccagaatacttggaggaacttcctacaatgatgcagcacttctcacag
ttcctggggaagaggccatggtttgttggagacaagatcacctttgtagatttcctcgcc
tatgatgtccttgacctccaccgtatatttgagcccaactgcttggacgcctttccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaaaacctctgtacacaagggtggctgtctggggcaacaagtaa

KEGG   Homo sapiens (human): 2949Help
Entry
2949              CDS       T01001                                 

Gene name
GSTM5, GSTM5-5, GTM5
Definition
(RefSeq) glutathione S-transferase mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2949 (GSTM5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2949 (GSTM5)
   00982 Drug metabolism - cytochrome P450
    2949 (GSTM5)
   00983 Drug metabolism - other enzymes
    2949 (GSTM5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2949 (GSTM5)
   05204 Chemical carcinogenesis
    2949 (GSTM5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2949 (GSTM5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2949 (GSTM5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2949 (GSTM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2949 (GSTM5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2949 (GSTM5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2949 (GSTM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2949
NCBI-ProteinID: NP_000842
OMIM: 138385
HGNC: 4637
Ensembl: ENSG00000134201
Vega: OTTHUMG00000011644
Pharos: P46439(Tbio)
UniProt: P46439 Q5T8R2
Position
1p13.3
AA seq 218 aa AA seqDB search
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLN
LKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgactctggggtactgggacatccgtgggctggcccacgccatccgcttgctc
ctggaatacacagactcaagctatgtggaaaagaagtacacgctgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaatgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggttatggataaccacatggagctggtcagactgtgctatgacccagatttt
gagaaactgaagccaaaatacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggagacaagatcacctttgtggatttccttgcc
tatgatgtccttgacatgaagcgtatatttgagcccaagtgcttggacgccttcctaaac
ttgaaggacttcatctcccgctttgagggtttgaagaagatctctgcctacatgaagtcc
agccaattcctccgaggtcttttgtttggaaagtcagctacatggaacagcaaatag

KEGG   Homo sapiens (human): 2950Help
Entry
2950              CDS       T01001                                 

Gene name
GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05215  Prostate cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00024  Prostate cancer
Drug target
Ezatiostat hydrochloride: D08917
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2950 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2950 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    2950 (GSTP1)
   00983 Drug metabolism - other enzymes
    2950 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2950 (GSTP1)
   05204 Chemical carcinogenesis
    2950 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2950 (GSTP1)
   05215 Prostate cancer
    2950 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2950 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2950 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2950 (GSTP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2950 (GSTP1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2950 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 2950
NCBI-ProteinID: NP_000843
OMIM: 134660
HGNC: 4638
Ensembl: ENSG00000084207
Vega: OTTHUMG00000137430
Pharos: P09211(Tchem)
UniProt: P09211 V9HWE9
Structure
PDB: 

Position
11q13.2
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

KEGG   Homo sapiens (human): 2952Help
Entry
2952              CDS       T01001                                 

Gene name
GSTT1
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2952 (GSTT1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2952 (GSTT1)
   00982 Drug metabolism - cytochrome P450
    2952 (GSTT1)
   00983 Drug metabolism - other enzymes
    2952 (GSTT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2952 (GSTT1)
   05204 Chemical carcinogenesis
    2952 (GSTT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2952 (GSTT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2952 (GSTT1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2952 (GSTT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2952 (GSTT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2952 (GSTT1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2952 (GSTT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 2952
NCBI-ProteinID: NP_000844
OMIM: 600436
HGNC: 4641
Pharos: P30711(Tbio)
UniProt: P30711
Structure
PDB: 

Position
22q11.23
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttacatcttt
gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac
ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg
gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc
cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc
cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg
gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt
cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaagtcttcgaaggccgacccaagctggccacatggcggcagcgcgtggaggca
gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc
ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg
tga

KEGG   Homo sapiens (human): 2953Help
Entry
2953              CDS       T01001                                 

Gene name
GSTT2
Definition
(RefSeq) glutathione S-transferase theta 2 (gene/pseudogene)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2953 (GSTT2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2953 (GSTT2)
   00982 Drug metabolism - cytochrome P450
    2953 (GSTT2)
   00983 Drug metabolism - other enzymes
    2953 (GSTT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2953 (GSTT2)
   05204 Chemical carcinogenesis
    2953 (GSTT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2953 (GSTT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2953 (GSTT2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2953 (GSTT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2953 (GSTT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2953 (GSTT2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2953 (GSTT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 2953
NCBI-ProteinID: NP_000845
OMIM: 600437
HGNC: 4642
Ensembl: ENSG00000099984
Vega: OTTHUMG00000150786
Pharos: P0CG29(Tbio)
UniProt: P0CG29
Structure
PDB: 

Position
22q11.23
AA seq 244 aa AA seqDB search
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagagctgtttcttgacctggtgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttagagctgcgcaccgtggatttggtcaaagggcagcac
aagagcaaggagttcttgcagatcaacagcctggggaaactgccgacgctcaaggatggt
gatttcatcttgaccgaaagctcggccatcctgatttacctgagctgtaagtaccagacg
ccggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggc
tggcatgccgactgcatccgtggcacctttggtatacccctgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccaaggagaaggtggaacgcaacaggactgccatggac
caggccctgcaatggctggaggacaagttcctgggggacaggcccttcctcgctggccag
caggtgacactggctgatctcatggccctggaggagctgatgcagccggtggctctcggc
tatgaactgtttgagggacggccacgactggcagcatggcgtggacgagtggaggctttc
ctgggtgctgagctatgccaggaggcccacagcatcatcttgagcatcctggaacaggcg
gccaagaaaaccctcccaacaccctcaccagaggcctatcaggctatgctgcttcgaatc
gccaggatcccctga

KEGG   Homo sapiens (human): 373156Help
Entry
373156            CDS       T01001                                 

Gene name
GSTK1, GST, GST_13-13, GST13, GST13-13, GSTK1-1, hGSTK1
Definition
(RefSeq) glutathione S-transferase kappa 1
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04146  Peroxisome
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    373156 (GSTK1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    373156 (GSTK1)
   00982 Drug metabolism - cytochrome P450
    373156 (GSTK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    373156 (GSTK1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    373156 (GSTK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     373156 (GSTK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSBA EAL Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 373156
NCBI-ProteinID: NP_057001
OMIM: 602321
HGNC: 16906
Ensembl: ENSG00000197448
Vega: OTTHUMG00000152637
Pharos: Q9Y2Q3(Tchem)
UniProt: Q9Y2Q3 Q6FII1
Structure
PDB: 

Position
7q34
AA seq 226 aa AA seqDB search
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggggcccctgccgcgcaccgtggagctcttctatgacgtgctgtccccctactcctgg
ctgggcttcgagatcctgtgccggtatcagaatatctggaacatcaacctgcagttgcgg
cccagcctcataacagggatcatgaaagacagtggaaacaagcctccaggtctgcttccc
cgcaaaggactatacatggcaaatgacttaaagctcctgagacaccatctccagattccc
atccacttccccaaggatttcttgtctgtgatgcttgaaaaaggaagtttgtctgccatg
cgtttcctcaccgccgtgaacttggagcatccagagatgctggagaaagcgtcccgggag
ctgtggatgcgcgtctggtcaaggaatgaagacatcaccgagccgcagagcatcctggcg
gctgcagagaaggctggtatgtctgcagaacaagcccagggacttctggaaaagatcgca
acgccaaaggtgaagaaccagctcaaggagaccactgaggcagcctgcagatacggagcc
tttgggctgcccatcaccgtggcccatgtggatggccaaacccacatgttatttggctct
gaccggatggagctgctggcgcacctgctgggagagaagtggatgggccctatacctcca
gccgtgaatgccagactttaa

KEGG   Homo sapiens (human): 4257Help
Entry
4257              CDS       T01001                                 

Gene name
MGST1, GST12, MGST, MGST-I
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4257 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4257 (MGST1)
   00982 Drug metabolism - cytochrome P450
    4257 (MGST1)
   00983 Drug metabolism - other enzymes
    4257 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4257 (MGST1)
   05204 Chemical carcinogenesis
    4257 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4257 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4257 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4257 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4257 (MGST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4257 (MGST1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4257 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4257
NCBI-ProteinID: NP_001247440
OMIM: 138330
HGNC: 7061
Ensembl: ENSG00000008394
Vega: OTTHUMG00000168816
Pharos: P10620(Tbio)
UniProt: P10620 A0A024RAX2
Position
12p12.3
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcatcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttgagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

KEGG   Homo sapiens (human): 4258Help
Entry
4258              CDS       T01001                                 

Gene name
MGST2, GST2, MGST-II
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4258 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4258 (MGST2)
   00982 Drug metabolism - cytochrome P450
    4258 (MGST2)
   00983 Drug metabolism - other enzymes
    4258 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4258 (MGST2)
   05204 Chemical carcinogenesis
    4258 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4258 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4258 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4258 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4258 (MGST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4258 (MGST2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4258 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4258
NCBI-ProteinID: NP_001191295
OMIM: 601733
HGNC: 7063
Ensembl: ENSG00000085871
Vega: OTTHUMG00000133382
Pharos: Q99735(Tbio)
UniProt: Q99735
Position
4q31.1
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacgcccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctatattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatatatggccgtcacctatacttctggggatattcagaagct
gctaaaaaacggatcaccggtttccgactgagtctggggattttggccttgttgaccctc
ctaggtgccctgggaattgcaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

KEGG   Homo sapiens (human): 4259Help
Entry
4259              CDS       T01001                                 

Gene name
MGST3, GST-III
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4259 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4259 (MGST3)
   00982 Drug metabolism - cytochrome P450
    4259 (MGST3)
   00983 Drug metabolism - other enzymes
    4259 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4259 (MGST3)
   05204 Chemical carcinogenesis
    4259 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4259 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4259 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4259 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4259 (MGST3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4259 (MGST3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4259 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4259
NCBI-ProteinID: NP_004519
OMIM: 604564
HGNC: 7064
Ensembl: ENSG00000143198
Vega: OTTHUMG00000034627
Pharos: O14880(Tbio)
UniProt: O14880 A0A024R8Z1
Position
1q24.1
AA seq 152 aa AA seqDB search
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggttttgtgcttctaactggtgctgccagctttata
atggtggcccacctagccatcaatgtttccaaggcccgcaagaagtacaaagtggagtat
cctatcatgtacagcacggaccctgaaaatgggcacatcttcaactgcattcagcgagcc
caccagaacacgttggaagtgtatcctcccttcttattttttctagctgttggaggtgtt
taccacccgcgtatagcttctggcctgggcttggcctggattgttggacgagttctttat
gcttatggctattacacgggagaacccagcaagcgtagtcgaggagccctggggtccatc
gccctcctgggcttggtgggcacaactgtgtgctctgctttccagcatcttggttgggtt
aaaagtggcttgggcagtggacccaaatgctgccattaa

KEGG   Homo sapiens (human): 653689Help
Entry
653689            CDS       T01001                                 

Gene name
GSTT2B, GSTT2P
Definition
(RefSeq) glutathione S-transferase theta 2B (gene/pseudogene)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    653689 (GSTT2B)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    653689 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    653689 (GSTT2B)
   00983 Drug metabolism - other enzymes
    653689 (GSTT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    653689 (GSTT2B)
   05204 Chemical carcinogenesis
    653689 (GSTT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    653689 (GSTT2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    653689 (GSTT2B)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    653689 (GSTT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    653689 (GSTT2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     653689 (GSTT2B)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   653689 (GSTT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 653689
NCBI-ProteinID: NP_001074312
HGNC: 33437
Ensembl: ENSG00000133433
Vega: OTTHUMG00000150774
Pharos: P0CG30(Tbio)
UniProt: P0CG30 G9J6Q5
Structure
PDB: 

Position
22q11.23
AA seq 244 aa AA seqDB search
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagagctgtttcttgacctggtgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttagagctgcgcaccgtggatttggtcaaagggcagcac
aagagcaaggagttcttgcagatcaacagcctggggaaactgccgacgctcaaggatggt
gatttcatcttgaccgaaagctcggccatcctgatttacctgagctgtaagtaccagacg
ccggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggc
tggcatgccgactgcatccgtggcacctttggtatacccctgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccgaggagaaggtggaacgcaacaggactgccatggac
caggccctgcaatggctggaggacaagttcctgggggacaggcccttcctcgctggccag
caggtgacactggctgatctcatggccctggaggagctgatgcagccggtggctctcggc
tatgaactgtttgagggacggccacgactggcagcatggcgtggacgagtggaggctttc
ctgggtgctgagctatgccaggaggcccacagcatcatcttgagcatcctggaacaggcg
gccaagaaaaccctcccaacaccctcaccagaggcctatcaggctatgctgcttcgaatc
gccaggatcccctga

KEGG   Homo sapiens (human): 9446Help
Entry
9446              CDS       T01001                                 

Gene name
GSTO1, GSTO_1-1, GSTTLp28, HEL-S-21, P28, SPG-R
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9446 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    9446 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    9446 (GSTO1)
   00983 Drug metabolism - other enzymes
    9446 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9446 (GSTO1)
   05204 Chemical carcinogenesis
    9446 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    9446 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9446 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    9446 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9446 (GSTO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     9446 (GSTO1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   9446 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 9446
NCBI-ProteinID: NP_004823
OMIM: 605482
HGNC: 13312
Ensembl: ENSG00000148834
Vega: OTTHUMG00000019001
Pharos: P78417(Tbio)
UniProt: P78417 V9HWG9
Structure
PDB: 

Position
10q25.1
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcttggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcatctacagcatgaggttctgcccgtttgctgagaggacgcgtcta
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctacgagtctgccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgaccttctttggtggcaattctatctctatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagaccacactccaaaactgaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgcttactagtgagaaa
gactggcaaggtttcctagagctctacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system