KEGG   Homo sapiens (human): 119504
Entry
119504            CDS       T01001                                 

Symbol
ANAPC16, APC16, C10orf104, CENP-27, MSAG, bA570G20.3
Name
(RefSeq) anaphase promoting complex subunit 16
  KO
K25229  anaphase-promoting complex subunit 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    119504 (ANAPC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    119504 (ANAPC16)
   04114 Oocyte meiosis
    119504 (ANAPC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    119504 (ANAPC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119504 (ANAPC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    119504 (ANAPC16)
   03036 Chromosome and associated proteins [BR:hsa03036]
    119504 (ANAPC16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     119504 (ANAPC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    119504 (ANAPC16)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 119504
NCBI-ProteinID: NP_001229475
OMIM: 613427
HGNC: 26976
Ensembl: ENSG00000166295
Vega: OTTHUMG00000018433
Pharos: Q96DE5(Tdark)
UniProt: Q96DE5 C5H3H2
Structure
Position
10:72216012..72235860
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctgcttcatcatcatcctcctcagctggtggggtcagtggaagttctgtcactgga
tctggtttcagtgtctcagaccttgccccaccacggaaagcccttttcacctaccccaaa
ggagctggagagatgttagaagatggctctgagagattcctctgcgaatctgtttttagc
tatcaagtggcatccacgcttaaacaggtgaaacatgatcagcaagttgctcggatggaa
aaactagctggtttggtagaagagctggaggctgacgagtggcggtttaagcccatcgag
cagctgctgggattcaccccctcttcaggttga

DBGET integrated database retrieval system