KEGG   Homo sapiens (human): 119504
Entry
119504            CDS       T01001                                 

Gene name
ANAPC16, APC16, C10orf104, CENP-27, MSAG, bA570G20.3
Definition
(RefSeq) anaphase promoting complex subunit 16
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 119504
NCBI-ProteinID: NP_001229475
OMIM: 613427
HGNC: 26976
Ensembl: ENSG00000166295
Vega: OTTHUMG00000018433
Pharos: Q96DE5(Tdark)
UniProt: Q96DE5 C5H3H2
Structure
PDB: 

Position
10q22.1
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctgcttcatcatcatcctcctcagctggtggggtcagtggaagttctgtcactgga
tctggtttcagtgtctcagaccttgccccaccacggaaagcccttttcacctaccccaaa
ggagctggagagatgttagaagatggctctgagagattcctctgcgaatctgtttttagc
tatcaagtggcatccacgcttaaacaggtgaaacatgatcagcaagttgctcggatggaa
aaactagctggtttggtagaagagctggaggctgacgagtggcggtttaagcccatcgag
cagctgctgggattcaccccctcttcaggttga

DBGET integrated database retrieval system