KEGG   Homo sapiens (human): 1196Help
Entry
1196              CDS       T01001                                 

Gene name
CLK2
Definition
(RefSeq) CDC like kinase 2
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     1196 (CLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CLK family
   1196 (CLK2)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1196 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 1196
NCBI-ProteinID: NP_001281267
OMIM: 602989
HGNC: 2069
Ensembl: ENSG00000176444
Vega: OTTHUMG00000035873
Pharos: P49760(Tchem)
UniProt: P49760 A8K7I0
Structure
PDB: 

Position
1q22
AA seq 499 aa AA seqDB search
MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQC
VDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMC
ISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQ
PCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFA
RLRAEPPNKLWDSSRDISR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcctcgaaggtaccactcctcagagcgaggcagccgggggagttaccgtgaa
cactatcggagccgaaagcataagcgacgaagaagtcgctcctggtcaagtagtagtgac
cggacacgacggcgtcggcgagaggacagctaccatgtccgttctcgaagcagttatgat
gatcgttcgtccgaccggagggtgtatgaccggcgatactgtggcagctacagacgcaac
gattatagccgggatcggggagatgcctactatgacacagactatcggcattcctatgaa
tatcagcgggagaacagcagttaccgcagccagcgcagcagccggaggaagcacagacgg
cggaggaggcgcagccggacatttagccgctcatcttcgcagcacagcagccggagagcc
aagagtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaa
gagcgatatgaaatcgttagcaccttaggagaggggaccttcggccgagttgtacaatgt
gttgaccatcgcaggggtggggctcgagttgccctgaagatcattaagaatgtggagaag
tacaaggaagcagctcgacttgagatcaacgtgctagagaaaatcaatgagaaagaccct
gacaacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgt
atctcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctg
ccctaccccatccaccaagtgcgccacatggccttccagctgtgccaggctgtcaagttc
ctccatgataacaagctgacacatacagacctcaagcctgaaaatattctgtttgtgaat
tcagactatgagctcacctacaacctagagaagaagcgagatgagcgcagtgtgaagagc
acagctgtgcgggtggtagactttggcagtgccacctttgaccatgagcaccatagcacc
attgtctccactcgccattaccgagcaccagaagtcatccttgagttgggctggtcacag
ccttgtgatgtgtggagtataggctgcatcatctttgaatactatgtgggattcaccctc
ttccagacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcctatc
ccttcccggatgatccgaaagacaagaaagcagaaatatttttaccggggtcgcctggat
tgggatgagaacacatcagctgggcgctatgttcgtgagaactgcaaaccgctgcggcgg
tatctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgcta
gagtatgaaccagctaagcggctgaccttgggtgaagcccttcagcatcctttcttcgcc
cgccttcgggctgagccgcccaacaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system