KEGG   Homo sapiens (human): 119694Help
Entry
119694            CDS       T01001                                 

Gene name
OR51F2, OR11-23
Definition
(RefSeq) olfactory receptor family 51 subfamily F member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119694 (OR51F2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119694 (OR51F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 119694
NCBI-ProteinID: NP_001004753
HGNC: 15197
Ensembl: ENSG00000176925
Vega: OTTHUMG00000066508
Pharos: Q8NH61(Tdark)
UniProt: Q8NH61
Position
11p15.4
AA seq 342 aa AA seqDB search
MTETSLSSQCFPMSVLNNTIAEPLIFLLMGIPGLKATQYWISIPFCLLYVVAVSGNSMIL
FVVLCERSLHKPMYYFLSMLSATDLSLSLCTLSTTLGVFWFEAREINLNACIAQMFFLHG
FTFMESGVLLAMAFDRFVAICYPLRYTTILTNARIAKIGMSMLIRNVAVMLPVMLFVKRL
SFCSSMVLSHSYCYHVDLIQLSCTDNRINSILGLFALLSTTGFDCPCILLSYILIIRSVL
SIASSEERRKAFNTCTSHISAVSIFYLPLISLSLVHRYGHSAPPFVHIIMANVFLLIPPV
LNPIIYSVKIKQIQKAIIKVLIQKHSKSNHQLFLIRDKAIYE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacatccctgtcttctcagtgcttccctatgtcggtcctcaataataccatt
gctgagcctctgatcttcctcctgatgggcattccaggcctgaaagccacccagtactgg
atctccatccctttttgtctcctatatgttgttgccgtctctggaaatagcatgatcctg
tttgtggtcctctgtgaacggagcctccataagcctatgtactatttcctctctatgctt
tcagccacagacctgagcttgtccctgtgtacactttctactacccttggtgtcttctgg
tttgaagcccgagaaatcaacctaaatgcctgcattgcccagatgttctttctacacgga
tttactttcatggagtctggggttctactggccatggcctttgatcgttttgtggccatc
tgttacccactgagatacactaccatccttaccaatgcccgaattgccaagattgggatg
agcatgttgataagaaatgttgccgtcatgttgccagtcatgctctttgtcaagaggttg
tccttctgcagttctatggtcctttcacattcttactgctaccatgttgatctcatccaa
ctctcctgcacagacaataggatcaacagcatccttggtctgtttgcgcttttgtccact
acagggtttgactgcccttgcatcctgctctcctatatcctgatcattcgatctgtcctc
agcattgcttcctcagaagagaggcggaaagccttcaacacctgcacatcccacatcagt
gctgtttccatcttctacctccctctcatcagtttgtctcttgtccatcgctatggccat
tcagcacctccatttgtccacatcatcatggccaatgtctttctgctaatccctcctgtg
ctcaaccctattatttacagtgtaaagattaagcagattcaaaaggccattatcaaggtc
ttaattcagaagcactccaaatctaatcatcagctatttctgattagagataaagccatt
tatgaataa

DBGET integrated database retrieval system