KEGG   Homo sapiens (human): 119765Help
Entry
119765            CDS       T01001                                 

Gene name
OR4B1, OR11-106, OST208
Definition
(RefSeq) olfactory receptor family 4 subfamily B member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    119765 (OR4B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    119765 (OR4B1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    119765 (OR4B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 119765
NCBI-ProteinID: NP_001005470
HGNC: 8290
Ensembl: ENSG00000175619
Vega: OTTHUMG00000166576
Pharos: Q8NGF8(Tdark)
UniProt: Q8NGF8 A0A126GVH6
Position
11p11.2
AA seq 309 aa AA seqDB search
MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF
LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC
YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ
PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS
HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW
SKKENPGRE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacaagtaatgtgactgagttgattttcactggccttttccaggatccagct
gtgcagagtgtatgctttgtggtgtttctccccgtgtaccttgccacggtggtgggcaat
ggcctcatcgttctgacggtcagtatcagcaagagtctggattctcccatgtacttcttc
cttagctgcctgtccttggtggagatcagttattcctccactatcgcccctaaattcatc
atagacttacttgccaagattaaaaccatctctctggaaggctgtctgactcagatattc
ttcttccacttctttggggttgctgagatccttttgattgtggtgatggcctatgattgc
tacgtggccatttgcaagcctcttcattatatgaacattatcagtcgtcaactgtgtcac
cttctggtggctggttcctggctggggggcttttgtcactccataattcagattctcgtt
atcatccaattgcccttctgtggtcccaatgtgattgaccactatttctgtgacctccag
cctttattcaagcttgcctgcactgacaccttcatggagggggttattgtgttggccaac
agtggattattctctgtcttctccttcctcatcttggtgtcctcttatattgtcattctg
gtcaacttgaggaaccattctgcagaggggaggcacaaagccctctccacctgtgcttct
cacatcacagtggtcatcttgttttttggacctgctatcttcctctacatgcgaccttct
tccactttcactgaagataaacttgtggctgtattctacacggtcatcacccccatgctg
aaccccatcatttacacactcaggaatgcagaggtgaaaatcgccataagaagattgtgg
agcaaaaaggagaatccagggagggagtga

DBGET integrated database retrieval system