KEGG   Homo sapiens (human): 120
Entry
120               CDS       T01001                                 
Symbol
ADD3, ADDL, CPSQ3
Name
(RefSeq) adducin 3
  KO
K18622  adducin
Organism
hsa  Homo sapiens (human)
Disease
H01097  Spastic quadriplegic cerebral palsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    120 (ADD3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     120 (ADD3)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 120
NCBI-ProteinID: NP_001307520
OMIM: 601568
HGNC: 245
Ensembl: ENSG00000148700
Pharos: Q9UEY8(Tbio)
UniProt: Q9UEY8 Q5VU08 Q53FL4
Position
10:109996373..110135565
AA seq 706 aa
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLS
FSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAV
SSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALG
ETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGS
HQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGG
TPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQF
EDDDHGPPAPPNPFSHLTEGELEEYKRTIERKQQGLEDAEQELLSDDASSVSQIQSQTQS
PQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEI
TIKSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgagctcagatgccagccaaggcgtgattaccactcctcctcctcccagcatgcctcac
aaagagagatattttgaccgcatcaatgaaaatgacccagaatacattagggagaggaac
atgtctcctgatctacgacaagacttcaacatgatggagcagaggaaacgagttactcag
atcctgcaaagtcctgcctttcgggaagacttggaatgccttattcaagaacagatgaag
aaaggccacaacccaactggattactagcattacagcagattgcagattacatcatggcc
aattctttctcgggtttttcttcacctcctctcagtcttggcatggtcacacctatcaat
gaccttcctggtgcagatacatcctcatatgtgaagggagaaaaacttactcgctgtaaa
cttgccagcctgtacagacttgtagacttgtttggatgggcacacctggcaaatacctat
atctcagtaagaataagtaaggagcaagaccacattataataattcccagaggcctatct
ttttctgaagctacagcctccaatttggtgaaagtcaatataataggagaagtggttgac
cagggaagtaccaatttgaaaattgaccatacaggattcagtccccatgctgcaatctat
tcaacacgtcctgatgttaagtgtgtgatacacatccatacccttgcaacagcagctgta
tcctccatgaaatgtgggatccttccaatttctcaagagtctcttcttctgggagatgtt
gcctattatgactaccaagggtcacttgaagaacaggaggagagaattcaactgcagaag
gttctgggaccaagttgtaaggtgctggtactcaggaatcatggtgtggttgcacttgga
gaaacattagaggaggcttttcattatatttttaatgtgcaactagcctgtgagattcag
gtgcaggccctagcaggtgcaggtggagtagacaatctccatgtactggactttcagaag
tataaagctttcacttacactgtagcagcgtctggtggaggaggtgtgaatatgggttcc
catcaaaaatggaaggttggcgaaattgagtttgaagggcttatgaggactctggacaac
ttggggtatagaacaggctatgcttacaggcatcctctcattcgagagaagcctaggcac
aagagtgatgtggaaatcccagcaactgtgactgctttttcctttgaagacgatacagtg
ccactctctcctctcaaatacatggcacagaggcaacagcgtgaaaaaacaagatggctg
aactcaccaaatacttacatgaaagtgaatgtgcctgaggagtctcggaacggagaaacc
agtccccgaaccaaaatcacgtggatgaaagcagaagactcatctaaagttagtggtgga
acacctatcaaaattgaagatccaaatcagtttgttcctttaaacacaaacccgaatgag
gtactagaaaagagaaataagattcgggaacaaaatcgatatgacttgaaaacagcagga
ccacaatctcagttgcttgctggaattgttgtggataagccaccttctactatgcaattt
gaagatgatgatcatggcccaccagctcctcctaacccatttagtcatctcacagaagga
gaacttgaagagtataagaggacaatcgaacgtaaacaacaaggcctagaagatgctgag
caggaattactctcagatgacgcttcatctgtttcacaaattcagtctcaaactcagtca
ccgcaaaatgtccctgaaaaattagaagaaaaccatgagctgttttccaagagcttcatc
tccatggaagtgcctgtcatggtagtaaatggcaaggatgatatgcatgatgttgaagat
gagcttgctaagcgagtgagtaggttaagcacaagtacaaccatagaaaacatcgagatt
actattaagtctccagagaaaatcgaagaagtcctgtcacctgaaggctccccttcaaaa
tcgccatccaagaaaaagaagaaattccgcactccttcttttctgaaaaagaacaaaaaa
aaggagaaagttgaggcctaa

DBGET integrated database retrieval system