KEGG   Homo sapiens (human): 1200Help
Entry
1200              CDS       T01001                                 

Gene name
TPP1, CLN2, GIG1, LPIC, SCAR7, TPP-1
Definition
(RefSeq) tripeptidyl peptidase 1
  KO
K01279  tripeptidyl-peptidase I [EC:3.4.14.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00149  Neuronal ceroid lipofuscinosis
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1200 (TPP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1200 (TPP1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1200 (TPP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1200 (TPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.9  tripeptidyl-peptidase I
     1200 (TPP1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S53
   1200 (TPP1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   1200 (TPP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1200 (TPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-GeneID: 1200
NCBI-ProteinID: NP_000382
OMIM: 607998
HGNC: 2073
Ensembl: ENSG00000166340
Vega: OTTHUMG00000133404
Pharos: O14773(Tbio)
UniProt: O14773
Structure
PDB: 

Position
11p15.4
AA seq 563 aa AA seqDB search
MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVER
LSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFL
TCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTS
SLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDL
AQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG
QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGD
SGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS
YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPV
FGGILSLINEHRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGP
GWDPVTGWGTPNFPALLKTLLNP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggactccaagcctgcctcctagggctctttgccctcatcctctctggcaaatgcagt
tacagcccggagcccgaccagcggaggacgctgcccccaggctgggtgtccctgggccgt
gcggaccctgaggaagagctgagtctcacctttgccctgagacagcagaatgtggaaaga
ctctcggagctggtgcaggctgtgtcggatcccagctctcctcaatacggaaaatacctg
accctagagaatgtggctgatctggtgaggccatccccactgaccctccacacggtgcaa
aaatggctcttggcagccggagcccagaagtgccattctgtgatcacacaggactttctg
acttgctggctgagcatccgacaagcagagctgctgctccctggggctgagtttcatcac
tatgtgggaggacctacggaaacccatgttgtaaggtccccacatccctaccagcttcca
caggccttggccccccatgtggactttgtggggggactgcaccgttttcccccaacatca
tccctgaggcaacgtcctgagccgcaggtgacagggactgtaggcctgcatctgggggta
accccctctgtgatccgtaagcgatacaacttgacctcacaagacgtgggctctggcacc
agcaataacagccaagcctgtgcccagttcctggagcagtatttccatgactcagacctg
gctcagttcatgcgcctcttcggtggcaactttgcacatcaggcatcagtagcccgtgtg
gttggacaacagggccggggccgggccgggattgaggccagtctagatgtgcagtacctg
atgagtgctggtgccaacatctccacctgggtctacagtagccctggccggcatgaggga
caggagcccttcctgcagtggctcatgctgctcagtaatgagtcagccctgccacatgtg
catactgtgagctatggagatgatgaggactccctcagcagcgcctacatccagcgggtc
aacactgagctcatgaaggctgccgctcggggtctcaccctgctcttcgcctcaggtgac
agtggggccgggtgttggtctgtctctggaagacaccagttccgccctaccttccctgcc
tccagcccctatgtcaccacagtgggaggcacatccttccaggaacctttcctcatcaca
aatgaaattgttgactatatcagtggtggtggcttcagcaatgtgttcccacggccttca
taccaggaggaagctgtaacgaagttcctgagctctagcccccacctgccaccatccagt
tacttcaatgccagtggccgtgcctacccagatgtggctgcactttctgatggctactgg
gtggtcagcaacagagtgcccattccatgggtgtccggaacctcggcctctactccagtg
tttggggggatcctatccttgatcaatgagcacaggatccttagtggccgcccccctctt
ggctttctcaacccaaggctctaccagcagcatggggcaggactctttgatgtaacccgt
ggctgccatgagtcctgtctggatgaagaggtagagggccagggtttctgctctggtcct
ggctgggatcctgtaacaggctggggaacacccaacttcccagctttgctgaagactcta
ctcaacccctga

DBGET integrated database retrieval system