KEGG   Homo sapiens (human): 120071
Entry
120071            CDS       T01001                                 

Gene name
LARGE2, GYLTL1B, PP5656
Definition
(RefSeq) LARGE xylosyl- and glucuronyltransferase 2
  KO
K09668  glycosyltransferase-like protein LARGE [EC:2.4.2.- 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00515  Mannose type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00872  O-glycan biosynthesis, mannose type (core M3)
Network
nt06013  O-Glycan biosynthesis
  Element
N00699  Mannose type O-glycan biosynthesis, FKTN to LARGE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    120071 (LARGE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    120071 (LARGE2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     120071 (LARGE2)
   2.4.2  Pentosyltransferases
    2.4.2.-  
     120071 (LARGE2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   120071 (LARGE2)
SSDB
Motif
Pfam: Glyco_transf_49 Glyco_transf_8 Glyco_transf_24 Nucleotid_trans
Other DBs
NCBI-GeneID: 120071
NCBI-ProteinID: NP_001287650
OMIM: 609709
HGNC: 16522
Ensembl: ENSG00000165905
Vega: OTTHUMG00000167037
Pharos: Q8N3Y3(Tbio)
UniProt: Q8N3Y3
Position
11p11.2
AA seq 721 aa
MLPRGRPRALGAAALLLLLLLLGFLLFGGDLGCERREPGGRAGAPGCFPGPLMPRVPPDG
RLRRAAALDGDPGAGPGDHNRSDCGPQPPPPPKCELLHVAIVCAGHNSSRDVITLVKSML
FYRKNPLHLHLVTDAVARNILETLFHTWMVPAVRVSFYHADQLKPQVSWIPNKHYSGLYG
LMKLVLPSALPAELARVIVLDTDVTFASDISELWALFAHFSDTQAIGLVENQSDWYLGNL
WKNHRPWPALGRGFNTGVILLRLDRLRQAGWEQMWRLTARRELLSLPATSLADQDIFNAV
IKEHPGLVQRLPCVWNVQLSDHTLAERCYSEASDLKVIHWNSPKKLRVKNKHVEFFRNFY
LTFLEYDGNLLRRELFVCPSQPPPGAEQLQQALAQLDEEDPCFEFRQQQLTVHRVHVTFL
PHEPPPPRPHDVTLVAQLSMDRLQMLEALCRHWPGPMSLALYLTDAEAQQFLHFVEASPV
LAARQDVAYHVVYREGPLYPVNQLRNVALAQALTPYVFLSDIDFLPAYSLYDYLRASIEQ
LGLGSRRKAALVVPAFETLRYRFSFPHSKVELLALLDAGTLYTFRYHEWPRGHAPTDYAR
WREAQAPYRVQWAANYEPYVVVPRDCPRYDPRFVGFGWNKVAHIVELDAQEYELLVLPEA
FTIHLPHAPSLDISRFRSSPTYRDCLQALKDEFHQDLSRHHGAAALKYLPALQQPQSPAR
G
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgctgccccgagggcgcccccgggcgctgggggccgccgcgctgttgctgctgctgctg
ctgctcggattcctcctgttcggtggggacctggggtgtgagcgccgcgagcctggcggg
cgagcgggggccccgggatgcttccccggcccgctcatgccacgtgtccccccagacggg
aggctgcggagagccgccgccctcgacggagacccgggggccggccccggggaccacaac
cgctccgactgcggcccgcagccgccgccgccgcccaagtgcgagctcttgcatgtggcc
atcgtgtgtgcggggcataactccagccgagacgtcatcaccctggtgaagtccatgctc
ttctacaggaaaaatccactgcacctccacttggtgactgacgccgtggccagaaacatc
ctggagacgctcttccacacatggatggtgcctgctgtccgtgtcagcttttatcatgcc
gaccagctcaagccccaggtctcctggatccccaacaagcactactccggcctctatggg
ctaatgaagctggtgctgcccagtgccttgcctgctgagctggcccgcgtcattgtcctg
gacacggatgtcaccttcgcctctgacatctcggagctctgggccctctttgctcacttt
tctgacacgcaggcgatcggtcttgtggagaaccagagtgactggtacctgggcaacctc
tggaagaaccacaggccctggcctgccttgggccggggatttaacacaggtgtgatcctg
ctgcggctggaccggctccggcaggctggctgggagcagatgtggaggctgacagccagg
cgggagctccttagcctgcctgccacctcactggctgaccaggacatcttcaacgctgtg
atcaaggagcacccggggctagtgcagcgtctgccttgtgtctggaatgtgcagctgtca
gatcacacactggccgagcgctgctactctgaggcgtctgacctcaaggtgatccactgg
aactcaccaaagaagcttcgggtgaagaacaagcatgtggaattcttccgcaatttctac
ctgaccttcctggagtacgatgggaacctgctgcggagagagctctttgtgtgccccagc
cagcccccacctggtgctgagcagttgcagcaggccctggcacaactggacgaggaagac
ccctgctttgagttccggcagcagcagctcactgtgcaccgtgtgcatgtcactttcctg
ccccatgaaccgccacccccccggcctcacgatgtcacccttgtggcccagctgtccatg
gaccggctgcagatgttggaagccctgtgcaggcactggcctggccccatgagcctggcc
ttgtacctgacagacgcagaagctcagcagttcctgcatttcgtcgaggcctcaccagtg
cttgctgcccggcaggacgtggcctaccatgtggtgtaccgtgaggggcccctatacccc
gtcaaccagcttcgcaacgtggccttggcccaggccctcacgccttacgtcttcctcagt
gacattgacttcctgcctgcctattctctctacgactacctcagggcctccattgagcag
ctggggctgggcagccggcgcaaggcagcactggtggtgccggcattcgagaccctgcgc
taccgcttcagcttcccccattccaaggtggagctgttggccttgctggatgcgggcact
ctctacaccttcaggtaccacgagtggccccgaggccacgcacccacagactatgcccgc
tggcgggaggctcaggccccgtaccgtgtgcaatgggcggccaactatgaaccctacgtg
gtggtgccacgagactgtccccgctatgatcctcgctttgtgggcttcggctggaacaaa
gtggcccacattgtggagctggatgcccaggaatatgagctcctggtgctgcccgaggcc
ttcaccatccatctgccccacgctccaagcctggacatctcccgcttccgctccagcccc
acctatcgtgactgcctccaggccctcaaggacgaattccaccaggacttgtcccgccac
catggggctgctgccctcaaatacctcccagccctgcagcagccccagagccctgcccga
ggctga

DBGET integrated database retrieval system