KEGG   Homo sapiens (human): 120227Help
Entry
120227            CDS       T01001                                 

Gene name
CYP2R1
Definition
(RefSeq) cytochrome P450 family 2 subfamily R member 1
  KO
K07419  vitamin D 25-hydroxylase [EC:1.14.14.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00103  Cholecalciferol biosynthesis
Disease
H01143  Vitamin D-dependent rickets
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    120227 (CYP2R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    120227 (CYP2R1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.24  vitamin D 25-hydroxylase
     120227 (CYP2R1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   120227 (CYP2R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 120227
NCBI-ProteinID: NP_078790
OMIM: 608713
HGNC: 20580
Ensembl: ENSG00000186104
Vega: OTTHUMG00000165900
Pharos: Q6VVX0(Tbio)
UniProt: Q6VVX0
Structure
PDB: 

Position
11p15.2
AA seq 501 aa AA seqDB search
MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIGNIYSLAASSE
LPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTK
MGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKILEETKFFNDAIETYKGRPFDFK
QLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPF
GKHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENL
IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPY
TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVF
HPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPD
LKPRLGMTLQPQPYLICAERR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagctttggagagctgaagagggcgcggcggcgctcggcggcgcgctcttcctg
ctgctcttcgcgctaggggtccgccagctgctgaagcagaggcggccgatgggcttcccc
ccggggccgccggggctgccatttatcggcaacatctattccctggcagcctcatccgag
cttccccatgtctacatgagaaagcagagccaggtgtacggagagatcttcagtttagat
cttggaggcatatcaactgtggttctaaatggctatgatgtagtaaaggaatgccttgtt
catcaaagcgaaatttttgcagacagaccatgccttcctttattcatgaagatgacaaaa
atgggaggcttactcaattccagatatggccgaggatgggttgatcacagacgattagct
gtaaacagttttcgatattttggatatggccaaaagtcttttgaatctaaaatcttggaa
gaaaccaaatttttcaatgatgctattgaaacatacaaaggtagaccttttgactttaaa
cagttaataacgaatgctgtttcaaacataaccaatctgatcatttttggagaacgattc
acttatgaagacaccgattttcagcacatgattgagttatttagtgaaaatgtggaacta
gctgccagtgcctcagtcttcttgtataatgcctttccatggattggcatcctgcctttt
ggaaaacatcaacagctgtttagaaatgcagctgtagtctatgattttctctccagactc
attgaaaaagcttcagtcaacagaaagcctcagctacctcagcattttgttgatgcttat
ttagatgagatggatcaaggtaaaaatgacccatcatctactttctccaaagaaaaccta
attttctcagtgggtgaactcatcattgctggaactgaaactacaaccaatgtgctacgg
tgggcgattcttttcatggccctttatcctaatattcaaggacaagttcagaaagagatt
gatttaattatgggccctaatgggaagccttcttgggacgacaaatgcaaaatgccttat
actgaggcagttttgcatgaagttttaagattctgtaatatagttccattagggattttc
catgcaacctctgaagatgcagttgtacgtggttattccattcctaaaggcacaacagta
attacaaatctttattctgtacactttgatgaaaagtactggagagacccagaagtgttc
catcctgagcgatttctggacagcagtggatattttgccaagaaggaagctttggttcct
ttttccctaggaagaagacattgtcttggagaacacttggctcggatggaaatgttcttg
ttttttacagcattgcttcagaggtttcatttgcattttccacatgaactagttccagat
ctgaagcccaggttaggcatgacattgcagccccaaccctacctcatctgtgctgaaaga
cgctga

DBGET integrated database retrieval system