KEGG   Homo sapiens (human): 120237
Entry
120237            CDS       T01001                                 

Gene name
DBX1
Definition
(RefSeq) developing brain homeobox 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Homeodomain DUF2986 Homeobox_KN YdaS_antitoxin
Other DBs
NCBI-GeneID: 120237
NCBI-ProteinID: NP_001025036
HGNC: 33185
Ensembl: ENSG00000109851
Vega: OTTHUMG00000166043
Pharos: A6NMT0(Tbio)
UniProt: A6NMT0
Position
11p15.1
AA seq 343 aa
MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPT
ASMSPPRQGAPTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGP
RTETSPALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRR
GMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSK
ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHL
RDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgatgttccccggcctcctcgcgccccccgccgggtaccctagcctcctgcggcccacg
cccaccttgacgctgccccagtccttgcagtcggcattttccggccactccagcttcctg
gtggaggatctgatccgcatcagccgaccccccgcctacctgccccgcagcgtgcccacc
gccagcatgtcgccgcccaggcagggggcccccacggccctcaccgacacgggggcctcg
gacctgggctccccgggtcccggcagccgacggggcggctctccgccgactgccttctcc
cctgccagcgagacgacgtttctgaagtttggagtgaacgccatcctctcctcggggccc
agaacagaaacatccccagccttgctccagagcgtccctcccaagaccttcgcctttccc
tacttcgaagggtcttttcagcctttcatcagatcttcttatttcccagcttcctccagc
gtggtgcccatccccgggaccttctcctggccgctggccgcgcgcgggaagcctcggcgg
ggcatgctgcgtcgagcagtcttctccgacgtgcagcggaaggcgctggagaagatgttc
cagaagcagaagtacatcagcaagcccgaccgcaagaagctggcggccaagctgggcctg
aaagactcgcaggtgaaaatctggttccagaaccgacgcatgaaatggcggaactccaag
gagcgcgaactcctgtctagcgggggctgtcgcgagcagaccctgcccaccaagctcaat
ccgcacccggacctcagcgacgtgggccagaagggccctgggaacgaagaggaggaggag
ggcccgggcagccccagccaccgcctggcctaccacgcgtcctccgacccccagcacctg
cgggacccgcggctgccagggccgctgcccccctcgcccgcgcactcgagcagtcccggg
aaaccttcggacttctcagattccgaggaggaagaggagggcgaggaacaggaggaaatc
accgtgtcctag

DBGET integrated database retrieval system