KEGG   Homo sapiens (human): 120425Help
Entry
120425            CDS       T01001                                 

Gene name
JAML, AMICA, AMICA1, CREA7-1, CREA7-4, Gm638
Definition
(RefSeq) junction adhesion molecule like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 I-set Ig_6 Izumo-Ig PRIMA1
Motif
Other DBs
NCBI-GeneID: 120425
NCBI-ProteinID: NP_001091996
OMIM: 609770
HGNC: 19084
Ensembl: ENSG00000160593
Vega: OTTHUMG00000166965
Pharos: Q86YT9(Tbio)
UniProt: Q86YT9 B3KUI3
Position
11q23.3
AA seq 394 aa AA seqDB search
MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLS
PGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRL
KGESQVFKKAVVLHVLPEEPKELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEE
IVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVRESDGGNYTCSIHLGN
LVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTC
GNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEAT
YMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcccactgaaactcatcctgctgccagtgttactggattattccttgggcctg
aatgacttgaatgtttccccgcctgagctaacagtccatgtgggtgattcagctctgatg
ggatgtgttttccagagcacagaagacaaatgtatattcaagatagactggactctgtca
ccaggagagcacgccaaggacgaatatgtgctatactattactccaatctcagtgtgcct
attgggcgcttccagaaccgcgtacacttgatgggggacatcttatgcaatgatggctct
ctcctgctccaagatgtgcaagaggctgaccagggaacctatatctgtgaaatccgcctc
aaaggggagagccaggtgttcaagaaggcggtggtactgcatgtgcttccagaggagccc
aaagagctcatggtccatgtgggtggattgattcagatgggatgtgttttccagagcaca
gaagtgaaacacgtgaccaaggtagaatggatattttcaggacggcgcgcaaaggaggag
attgtatttcgttactaccacaaactcaggatgtctgtggagtactcccagagctggggc
cacttccagaatcgtgtgaacctggtgggggacattttccgcaatgacggttccatcatg
cttcaaggagtgagggagtcagatggaggaaactacacctgcagtatccacctagggaac
ctggtgttcaagaaaaccattgtgctgcatgtcagcccggaagagcctcgaacactggtg
accccggcagccctgaggcctctggtcttgggtggtaatcagttggtgatcattgtggga
attgtctgtgccacaatcctgctgctccctgttctgatattgatcgtgaagaagacctgt
ggaaataagagttcagtgaattctacagtcttggtgaagaacacgaagaagactaatcca
gagataaaagaaaaaccctgccattttgaaagatgtgaaggggagaaacacatttactcc
ccaataattgtacgggaggtgatcgaggaagaagaaccaagtgaaaaatcagaggccacc
tacatgaccatgcacccagtttggccttctctgaggtcagatcggaacaactcacttgaa
aaaaagtcaggtgggggaatgccaaaaacacagcaagccttttga

DBGET integrated database retrieval system