KEGG   Homo sapiens (human): 1208
Entry
1208              CDS       T01001                                 

Gene name
CLPS
Definition
(RefSeq) colipase
  KO
K14460  colipase
Organism
hsa  Homo sapiens (human)
Pathway
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    1208 (CLPS)
SSDB
Motif
Pfam: Colipase_C Colipase
Other DBs
NCBI-GeneID: 1208
NCBI-ProteinID: NP_001823
OMIM: 120105
HGNC: 2085
Ensembl: ENSG00000137392
Vega: OTTHUMG00000014578
Pharos: P04118(Tbio)
UniProt: P04118
Position
6p21.31
AA seq 112 aa
MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMA
SENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
NT seq 339 nt   +upstreamnt  +downstreamnt
atggagaagatcctgatcctcctgcttgtcgccctctctgtggcctatgcagctcctggc
ccccgggggatcattatcaacctggagaacggtgagctctgcatgaatagtgcccagtgt
aagagcaattgctgccagcattcaagtgcgctgggcctggcccgctgcacatccatggcc
agcgagaacagcgagtgctctgtcaagacgctctatgggatttactacaagtgtccctgt
gagcgtggcctgacctgtgagggagacaagaccatcgtgggctccatcaccaacaccaac
tttggcatctgccatgacgctggacgctccaagcagtga

DBGET integrated database retrieval system