KEGG   Homo sapiens (human): 120892
Entry
120892            CDS       T01001                                 

Gene name
LRRK2, AURA17, DARDARIN, PARK8, RIPK7, ROCO2
Definition
(RefSeq) leucine rich repeat kinase 2
  KO
K08844  leucine-rich repeat kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
Network
nt06414  Apoptosis
nt06463  Parkinson disease
  Element
N01047  Mutation-activated LRRK2 to intrinsic apoptotic pathway
Disease
H00057  Parkinson disease
H00066  Lewy body dementia (LBD)
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    120892 (LRRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    120892 (LRRK2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    120892 (LRRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    120892 (LRRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     120892 (LRRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  LRRK family
   120892 (LRRK2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    120892 (LRRK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   120892 (LRRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Roc LRR_8 COR LRR_4 Ras LRR_9 Arf Ank_2 ABC_tran T2SSE AAA_7 AAA_22 NB-ARC Kdo MMR_HSR1 PduV-EutP NACHT Septin TniB Gtr1_RagA cobW G-alpha MobB TrwB_AAD_bind AAA_16 FtsK_SpoIIIE TsaE AAA_29 AAA_23 SRPRB LRR_6 PQQ_2 AAA_33 ResIII Arm
Other DBs
NCBI-GeneID: 120892
NCBI-ProteinID: NP_940980
OMIM: 609007
HGNC: 18618
Ensembl: ENSG00000188906
Vega: OTTHUMG00000059742
Pharos: Q5S007(Tchem)
UniProt: Q5S007 Q17RV3
Structure
PDB: 
5MYC 2ZEJ 3D6T 6DLO 6DLP

Position
12q12
AA seq 2527 aa
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
DIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA
SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQ
NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTV
KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNH
ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI
RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK
HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI
LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ
SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV
KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
AQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
MRRTSVE
NT seq 7584 nt   +upstreamnt  +downstreamnt
atggctagtggcagctgtcaggggtgcgaagaggacgaggaaactctgaagaagttgata
gtcaggctgaacaatgtccaggaaggaaaacagatagaaacgctggtccaaatcctggag
gatctgctggtgttcacgtactccgagcgcgcctccaagttatttcaaggcaaaaatatc
catgtgcctctgttgatcgtcttggactcctatatgagagtcgcgagtgtgcagcaggtg
ggttggtcacttctgtgcaaattaatagaagtctgtccaggtacaatgcaaagcttaatg
ggaccccaggatgttggaaatgattgggaagtccttggtgttcaccaattgattcttaaa
atgctaacagttcataatgccagtgtaaacttgtcagtgattggactgaagaccttagat
ctcctcctaacttcaggtaaaatcaccttgctgatattggatgaagaaagtgatattttc
atgttaatttttgatgccatgcactcatttccagccaatgatgaagtccagaaacttgga
tgcaaagctttacatgtgctgtttgagagagtctcagaggagcaactgactgaatttgtt
gagaacaaagattatatgatattgttaagtgcgttaacaaattttaaagatgaagaggaa
attgtgcttcatgtgctgcattgtttacattccctagcgattccttgcaataatgtggaa
gtcctcatgagtggcaatgtcaggtgttataatattgtggtggaagctatgaaagcattc
cctatgagtgaaagaattcaagaagtgagttgctgtttgctccataggcttacattaggt
aattttttcaatatcctggtattaaacgaagtccatgagtttgtggtgaaagctgtgcag
cagtacccagagaatgcagcattgcagatctcagcgctcagctgtttggccctcctcact
gagactattttcttaaatcaagatttagaggaaaagaatgagaatcaagagaatgatgat
gagggggaagaagataaattgttttggctggaagcctgttacaaagcattaacgtggcat
agaaagaacaagcacgtgcaggaggccgcatgctgggcactaaataatctccttatgtac
caaaacagtttacatgagaagattggagatgaagatggccatttcccagctcatagggaa
gtgatgctctccatgctgatgcattcttcatcaaaggaagttttccaggcatctgcgaat
gcattgtcaactctcttagaacaaaatgttaatttcagaaaaatactgttatcaaaagga
atacacctgaatgttttggagttaatgcagaagcatatacattctcctgaagtggctgaa
agtggctgtaaaatgctaaatcatctttttgaaggaagcaacacttccctggatataatg
gcagcagtggtccccaaaatactaacagttatgaaacgtcatgagacatcattaccagtg
cagctggaggcgcttcgagctattttacattttatagtgcctggcatgccagaagaatcc
agggaggatacagaatttcatcataagctaaatatggttaaaaaacagtgtttcaagaat
gatattcacaaactggtcctagcagctttgaacaggttcattggaaatcctgggattcag
aaatgtggattaaaagtaatttcttctattgtacattttcctgatgcattagagatgtta
tccctggaaggtgctatggattcagtgcttcacacactgcagatgtatccagatgaccaa
gaaattcagtgtctgggtttaagtcttataggatacttgattacaaagaagaatgtgttc
ataggaactggacatctgctggcaaaaattctggtttccagcttataccgatttaaggat
gttgctgaaatacagactaaaggatttcagacaatcttagcaatcctcaaattgtcagca
tctttttctaagctgctggtgcatcattcatttgacttagtaatattccatcaaatgtct
tccaatatcatggaacaaaaggatcaacagtttctaaacctctgttgcaagtgttttgca
aaagtagctatggatgattacttaaaaaatgtgatgctagagagagcgtgtgatcagaat
aacagcatcatggttgaatgcttgcttctattgggagcagatgccaatcaagcaaaggag
ggatcttctttaatttgtcaggtatgtgagaaagagagcagtcccaaattggtggaactc
ttactgaatagtggatctcgtgaacaagatgtacgaaaagcgttgacgataagcattggg
aaaggtgacagccagatcatcagcttgctcttaaggaggctggccctggatgtggccaac
aatagcatttgccttggaggattttgtataggaaaagttgaaccttcttggcttggtcct
ttatttccagataagacttctaatttaaggaaacaaacaaatatagcatctacactagca
agaatggtgatcagatatcagatgaaaagtgctgtggaagaaggaacagcctcaggcagc
gatggaaatttttctgaagatgtgctgtctaaatttgatgaatggacctttattcctgac
tcttctatggacagtgtgtttgctcaaagtgatgacctggatagtgaaggaagtgaaggc
tcatttcttgtgaaaaagaaatctaattcaattagtgtaggagaattttaccgagatgcc
gtattacagcgttgctcaccaaatttgcaaagacattccaattccttggggcccattttt
gatcatgaagatttactgaagcgaaaaagaaaaatattatcttcagatgattcactcagg
tcatcaaaacttcaatcccatatgaggcattcagacagcatttcttctctggcttctgag
agagaatatattacatcactagacctttcagcaaatgaactaagagatattgatgcccta
agccagaaatgctgtataagtgttcatttggagcatcttgaaaagctggagcttcaccag
aatgcactcacgagctttccacaacagctatgtgaaactctgaagagtttgacacatttg
gacttgcacagtaataaatttacatcatttccttcttatttgttgaaaatgagttgtatt
gctaatcttgatgtctctcgaaatgacattggaccctcagtggttttagatcctacagtg
aaatgtccaactctgaaacagtttaacctgtcatataaccagctgtcttttgtacctgag
aacctcactgatgtggtagagaaactggagcagctcattttagaaggaaataaaatatca
gggatatgctcccccttgagactgaaggaactgaagattttaaaccttagtaagaaccac
atttcatccctatcagagaactttcttgaggcttgtcctaaagtggagagtttcagtgcc
agaatgaattttcttgctgctatgcctttcttgcctccttctatgacaatcctaaaatta
tctcagaacaaattttcctgtattccagaagcaattttaaatcttccacacttgcggtct
ttagatatgagcagcaatgatattcagtacctaccaggtcccgcacactggaaatctttg
aacttaagggaactcttatttagccataatcagatcagcatcttggacttgagtgaaaaa
gcatatttatggtctagagtagagaaactgcatctttctcacaataaactgaaagagatt
cctcctgagattggctgtcttgaaaatctgacatctctggatgtcagttacaacttggaa
ctaagatcctttcccaatgaaatggggaaattaagcaaaatatgggatcttcctttggat
gaactgcatcttaactttgattttaaacatataggatgtaaagccaaagacatcataagg
tttcttcaacagcgattaaaaaaggctgtgccttataaccgaatgaaacttatgattgtg
ggaaatactgggagtggtaaaaccaccttattgcagcaattaatgaaaaccaagaaatca
gatcttggaatgcaaagtgccacagttggcatagatgtgaaagactggcctatccaaata
agagacaaaagaaagagagatctcgtcctaaatgtgtgggattttgcaggtcgtgaggaa
ttctatagtactcatccccattttatgacgcagcgagcattgtaccttgctgtctatgac
ctcagcaagggacaggctgaagttgatgccatgaagccttggctcttcaatataaaggct
cgcgcttcttcttcccctgtgattctcgttggcacacatttggatgtttctgatgagaag
caacgcaaagcctgcatgagtaaaatcaccaaggaactcctgaataagcgagggttccct
gccatacgagattaccactttgtgaatgccaccgaggaatctgatgctttggcaaaactt
cggaaaaccatcataaacgagagccttaatttcaagatccgagatcagcttgttgttgga
cagctgattccagactgctatgtagaacttgaaaaaatcattttatcggagcgtaaaaat
gtgccaattgaatttcccgtaattgaccggaaacgattattacaactagtgagagaaaat
cagctgcagttagatgaaaatgagcttcctcacgcagttcactttctaaatgaatcagga
gtccttcttcattttcaagacccagcactgcagttaagtgacttgtactttgtggaaccc
aagtggctttgtaaaatcatggcacagattttgacagtgaaagtggaaggttgtccaaaa
caccctaagggcattatttcgcgtagagatgtggaaaaatttctttcaaaaaaaaggaaa
tttccaaagaactacatgtcacagtattttaagctcctagaaaaattccagattgctttg
ccaataggagaagaatatttgctggttccaagcagtttgtctgaccacaggcctgtgata
gagcttccccattgtgagaactctgaaattatcatccgactatatgaaatgccttatttt
ccaatgggattttggtcaagattaatcaatcgattacttgagatttcaccttacatgctt
tcagggagagaacgagcacttcgcccaaacagaatgtattggcgacaaggcatttactta
aattggtctcctgaagcttattgtctggtaggatctgaagtcttagacaatcatccagag
agtttcttaaaaattacagttccttcttgtagaaaaggctgtattcttttgggccaagtt
gtggaccacattgattctctcatggaagaatggtttcctgggttgctggagattgatatt
tgtggtgaaggagaaactctgttgaagaaatgggcattatatagttttaatgatggtgaa
gaacatcaaaaaatcttacttgatgacttgatgaagaaagcagaggaaggagatctctta
gtaaatccagatcaaccaaggctcaccattccaatatctcagattgcccctgacttgatt
ttggctgacctgcctagaaatattatgttgaataatgatgagttggaatttgaacaagct
ccagagtttctcctaggtgatggcagttttggatcagtttaccgagcagcctatgaagga
gaagaagtggctgtgaagatttttaataaacatacatcactcaggctgttaagacaagag
cttgtggtgctttgccacctccaccaccccagtttgatatctttgctggcagctgggatt
cgtccccggatgttggtgatggagttagcctccaagggttccttggatcgcctgcttcag
caggacaaagccagcctcactagaaccctacagcacaggattgcactccacgtagctgat
ggtttgagatacctccactcagccatgattatataccgagacctgaaaccccacaatgtg
ctgcttttcacactgtatcccaatgctgccatcattgcaaagattgctgactacggcatt
gctcagtactgctgtagaatggggataaaaacatcagagggcacaccagggtttcgtgca
cctgaagttgccagaggaaatgtcatttataaccaacaggctgatgtttattcatttggt
ttactactctatgacattttgacaactggaggtagaatagtagagggtttgaagtttcca
aatgagtttgatgaattagaaatacaaggaaaattacctgatccagttaaagaatatggt
tgtgccccatggcctatggttgagaaattaattaaacagtgtttgaaagaaaatcctcaa
gaaaggcctacttctgcccaggtctttgacattttgaattcagctgaattagtctgtctg
acgagacgcattttattacctaaaaacgtaattgttgaatgcatggttgctacacatcac
aacagcaggaatgcaagcatttggctgggctgtgggcacaccgacagaggacagctctca
tttcttgacttaaatactgaaggatacacttctgaggaagttgctgatagtagaatattg
tgcttagccttggtgcatcttcctgttgaaaaggaaagctggattgtgtctgggacacag
tctggtactctcctggtcatcaataccgaagatgggaaaaagagacataccctagaaaag
atgactgattctgtcacttgtttgtattgcaattccttttccaagcaaagcaaacaaaaa
aattttcttttggttggaaccgctgatggcaagttagcaatttttgaagataagactgtt
aagcttaaaggagctgctcctttgaagatactaaatataggaaatgtcagtactccattg
atgtgtttgagtgaatccacaaattcaacggaaagaaatgtaatgtggggaggatgtggc
acaaagattttctccttttctaatgatttcaccattcagaaactcattgagacaagaaca
agccaactgttttcttatgcagctttcagtgattccaacatcataacagtggtggtagac
actgctctctatattgctaagcaaaatagccctgttgtggaagtgtgggataagaaaact
gaaaaactctgtggactaatagactgcgtgcactttttaagggaggtaatggtaaaagaa
aacaaggaatcaaaacacaaaatgtcttattctgggagagtgaaaaccctctgccttcag
aagaacactgctctttggataggaactggaggaggccatattttactcctggatctttca
actcgtcgacttatacgtgtaatttacaacttttgtaattcggtcagagtcatgatgaca
gcacagctaggaagccttaaaaatgtcatgctggtattgggctacaaccggaaaaatact
gaaggtacacaaaagcagaaagagatacaatcttgcttgaccgtttgggacatcaatctt
ccacatgaagtgcaaaatttagaaaaacacattgaagtgagaaaagaattagctgaaaaa
atgagacgaacatctgttgagtaa

DBGET integrated database retrieval system