KEGG   Homo sapiens (human): 1211Help
Entry
1211              CDS       T01001                                 

Gene name
CLTA, LCA
Definition
(RefSeq) clathrin light chain A
  KO
K04644  clathrin light chain A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1211 (CLTA)
   04142 Lysosome
    1211 (CLTA)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1211 (CLTA)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1211 (CLTA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    1211 (CLTA)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    1211 (CLTA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1211 (CLTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1211 (CLTA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1211 (CLTA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1211 (CLTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 1211
NCBI-ProteinID: NP_009027
OMIM: 118960
HGNC: 2090
Ensembl: ENSG00000122705
Vega: OTTHUMG00000019896
Pharos: P09496(Tbio)
UniProt: P09496
Position
9p13.3
AA seq 248 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggatccgttcggcgcccctgccggcgcccctggcggtcccgcgctgggg
aacggagtggccggcgccggcgaagaagacccggctgcggccttcttggcgcagcaagag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtaatgaat
ggtgaatactaccaggaaagtaatggtccaacagacagttatgcagctatttcacaagtg
gatcgattgcagtcagagcctgaaagtatccgtaaatggagagaagaacaaatggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaggcaata
aaggagctagaagaatggtatgcaagacaggacgagcagctacagaaaacaaaagcaaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtc
acaaacataaaccatccttgctacagcctagaacaggcagcagaagaagcctttgtaaat
gacattgacgagtcgtccccaggcactgagtgggaacgggtggcccggctgtgtgacttt
aaccccaagtctagcaagcaggccaaagatgtctcccgcatgcgctcagtcctcatctcc
ctcaagcaggccccgctggtgcactga

DBGET integrated database retrieval system