KEGG   Homo sapiens (human): 1211Help
Entry
1211              CDS       T01001                                 

Gene name
CLTA, LCA
Definition
(RefSeq) clathrin light chain A
  KO
K04644  clathrin light chain A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington's disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1211 (CLTA)
   04142 Lysosome
    1211 (CLTA)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1211 (CLTA)
  Nervous system
   04721 Synaptic vesicle cycle
    1211 (CLTA)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1211 (CLTA)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1211 (CLTA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1211 (CLTA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1211 (CLTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q FadA IncA ORC3_N
Motif
Other DBs
NCBI-GeneID: 1211
NCBI-ProteinID: NP_009027
OMIM: 118960
HGNC: 2090
Ensembl: ENSG00000122705
Vega: OTTHUMG00000019896
Pharos: P09496(Tbio)
UniProt: P09496
Position
9p13.3
AA seq 248 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggatccgttcggcgcccctgccggcgcccctggcggtcccgcgctgggg
aacggagtggccggcgccggcgaagaagacccggctgcggccttcttggcgcagcaagag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtaatgaat
ggtgaatactaccaggaaagtaatggtccaacagacagttatgcagctatttcacaagtg
gatcgattgcagtcagagcctgaaagtatccgtaaatggagagaagaacaaatggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaggcaata
aaggagctagaagaatggtatgcaagacaggacgagcagctacagaaaacaaaagcaaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtc
acaaacataaaccatccttgctacagcctagaacaggcagcagaagaagcctttgtaaat
gacattgacgagtcgtccccaggcactgagtgggaacgggtggcccggctgtgtgacttt
aaccccaagtctagcaagcaggccaaagatgtctcccgcatgcgctcagtcctcatctcc
ctcaagcaggccccgctggtgcactga

DBGET integrated database retrieval system