KEGG   Homo sapiens (human): 1211Help
Entry
1211              CDS       T01001                                 

Gene name
CLTA, LCA
Definition
(RefSeq) clathrin light chain A
  KO
K04644  clathrin light chain A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1211 (CLTA)
   04142 Lysosome
    1211 (CLTA)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1211 (CLTA)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1211 (CLTA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1211 (CLTA)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1211 (CLTA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1211 (CLTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1211 (CLTA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1211 (CLTA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1211 (CLTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 1211
NCBI-ProteinID: NP_009027
OMIM: 118960
HGNC: 2090
Ensembl: ENSG00000122705
Vega: OTTHUMG00000019896
Pharos: P09496(Tbio)
UniProt: P09496
Position
9p13.3
AA seq 248 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggatccgttcggcgcccctgccggcgcccctggcggtcccgcgctgggg
aacggagtggccggcgccggcgaagaagacccggctgcggccttcttggcgcagcaagag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtaatgaat
ggtgaatactaccaggaaagtaatggtccaacagacagttatgcagctatttcacaagtg
gatcgattgcagtcagagcctgaaagtatccgtaaatggagagaagaacaaatggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaggcaata
aaggagctagaagaatggtatgcaagacaggacgagcagctacagaaaacaaaagcaaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtc
acaaacataaaccatccttgctacagcctagaacaggcagcagaagaagcctttgtaaat
gacattgacgagtcgtccccaggcactgagtgggaacgggtggcccggctgtgtgacttt
aaccccaagtctagcaagcaggccaaagatgtctcccgcatgcgctcagtcctcatctcc
ctcaagcaggccccgctggtgcactga

KEGG   Homo sapiens (human): 1212Help
Entry
1212              CDS       T01001                                 

Gene name
CLTB, LCB
Definition
(RefSeq) clathrin light chain B
  KO
K04645  clathrin light chain B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1212 (CLTB)
   04142 Lysosome
    1212 (CLTB)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1212 (CLTB)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1212 (CLTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1212 (CLTB)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1212 (CLTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1212 (CLTB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1212 (CLTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q
Motif
Other DBs
NCBI-GeneID: 1212
NCBI-ProteinID: NP_009028
OMIM: 118970
HGNC: 2091
Ensembl: ENSG00000175416
Vega: OTTHUMG00000130662
Pharos: P09497(Tbio)
UniProt: P09497
Position
5q35.2
AA seq 229 aa AA seqDB search
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT
SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgactttggcttcttctcgtcgtcggagagcggtgccccggaggcggcggag
gaggacccggcggccgccttcctggcccagcaggagagcgagattgcaggcatagagaac
gacgagggcttcggggcacctgccggcagccatgcggcccccgcgcagccgggccccacg
agtggggctggttctgaggacatggggaccacagtcaatggagatgtgtttcaggaggcc
aacggtcctgctgatggctacgcagccattgcccaggctgacaggctgacccaggagcct
gagagcatccgcaagtggcgagaggagcagaggaaacggctgcaagagctggatgctgca
tctaaggtcacggaacaggaatggcgggagaaggccaagaaggacctggaggagtggaac
cagcgccagagtgaacaagtagagaagaacaagatcaacaaccggatcgctgacaaagca
ttctaccagcagccagatgctgatatcatcggctacgtggcatccgaggaggctttcgtg
aaggaatccaaggaggagaccccaggcacagagtgggagaaggtggcccagctatgtgac
ttcaaccccaagagcagcaagcagtgcaaagatgtgtcccgcctgcgctcggtgctcatg
tccctgaagcagacgccactgtcccgctag

KEGG   Homo sapiens (human): 1213Help
Entry
1213              CDS       T01001                                 

Gene name
CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc, MRD56
Definition
(RefSeq) clathrin heavy chain
  KO
K04646  clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1213 (CLTC)
   04142 Lysosome
    1213 (CLTC)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1213 (CLTC)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1213 (CLTC)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1213 (CLTC)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1213 (CLTC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1213 (CLTC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1213 (CLTC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1213 (CLTC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1213 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Motif
Other DBs
NCBI-GeneID: 1213
NCBI-ProteinID: NP_004850
OMIM: 118955
HGNC: 2092
Ensembl: ENSG00000141367
Vega: OTTHUMG00000134279
Pharos: Q00610(Tbio)
UniProt: Q00610
Structure
PDB: 

Position
17q23.1
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccctgactatggagtctgacaaattcatctgcatt
agagaaaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagctagcaaagtaatt
gcactgaaagctgggaaaactcttcagatttttaacattgaaatgaaaagtaaaatgaag
gctcataccatgactgatgatgtcaccttttggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcactggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgccattctagccttgcagggtgccagattatcaattaccgtacagatgca
aaacaaaagtggttacttctgactggtatatctgcacagcaaaatcgtgtggtgggagct
atgcagctatattctgtagataggaaagtgtctcagcccattgaaggacatgcagctagc
tttgcacagtttaagatggaaggaaatgcagaagaatcaacgttattttgttttgcagtt
cggggccaagctggagggaagttacatattattgaagttggcacaccacctacagggaac
cagccctttccaaagaaggcagtggatgtcttctttcctccagaagcacaaaatgatttt
cctgttgcaatgcagatcagtgaaaagcatgatgtggtgttcttgataaccaagtatggt
tatatccacctctatgatcttgagactggtacctgcatctacatgaatagaatcagtgga
gaaacaatttttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtgtgtgtggaagaagaaaacataattccttacatcaccaat
gttctacaaaatcctgatttggctctgagaatggctgtacgtaataacttagccggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcggaggca
gcaaaggtggctgctaatgcaccaaagggaattcttcgtactccagacactatccgtcgg
ttccagagtgtcccagcccagccaggtcaaacttctcctctacttcagtactttggtatc
cttttggaccagggacagctcaacaaatacgaatccttagagctttgtaggcctgtactt
cagcaagggcgaaaacagcttttggagaaatggttaaaagaagataagctggaatgttct
gaagaactgggtgatcttgtgaaatctgtggaccctacattggcacttagtgtgtaccta
agggctaacgtcccaaataaagtcattcagtgctttgcagaaacaggtcaagtccaaaag
attgttttatatgctaaaaaagttggatacactccagattggatatttctgctgagaaat
gtaatgcgaatcagtccagatcagggacagcagtttgcccaaatgttagttcaagatgaa
gagcctcttgctgacatcacacagattgtagatgtctttatggaatacaatctaattcag
cagtgtactgcattcttgcttgatgctctgaagaataatcgcccatctgaaggtccttta
cagacgcggttacttgagatgaaccttatgcatgcgcctcaagttgcagatgctattcta
ggcaatcagatgttcacacattatgaccgggctcatattgctcaactgtgtgaaaaggct
ggcctactgcagcgtgcattagaacatttcactgatttatatgatataaaacgtgcagtg
gttcacacccatcttcttaaccctgagtggttagtcaactactttggttccttatcagta
gaagactccctagaatgtctcagagccatgctgtctgccaacatccgtcagaatctgcag
atttgtgttcaggtggcttctaaatatcatgaacaactgtcaactcagtctctgattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttctgggatccattgttaac
tttagccaggacccagatgtgcactttaaatatattcaggcagcttgcaagactgggcaa
atcaaagaagtagaaagaatctgtagagaaagcaactgctacgatcctgagcgagtcaag
aattttcttaaggaagcaaaactaacagatcagctaccacttatcattgtgtgtgatcga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacagaaggtgaatccaagtcgacttcctgtagttattggaggattactt
gatgttgactgttctgaagatgtcataaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaatgccttagcc
aaaatctacatagacagtaataacaacccggagagatttcttcgtgaaaatccctactat
gacagtcgcgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccaatgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttctcgctacctggtacgtcgaaaggatccagaattgtggggcagcgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggttgtacaaacagctttgtct
gagactcaggaccctgaagaagtgtcagtaactgtaaaggctttcatgactgcagacctt
cctaatgaactcattgaactgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatctgcaaaacctccttatcctcactgcaattaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatattgccaatatcgccatc
agcaatgagctgtttgaagaagcatttgccattttccggaaatttgatgtcaatacttca
gcagttcaggtcttaattgagcatattggaaacttggatcgggcatatgagtttgctgaa
cgttgcaatgaacctgcggtctggagtcaacttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttatatcaaagcagatgatccttcctcctacatggaagtt
gttcaggctgccaatactagtggaaactgggaagaactggtgaagtacttgcagatggcc
cgtaagaaggctcgagagtcctatgtggagacagaactgatattcgcactggctaaaaca
aaccgccttgcagagttagaagaatttatcaatggaccaaataatgctcatatccaacaa
gttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttgttgtacaataat
gtttccaattttggacgtttggcatctaccctggttcacctgggtgaatatcaggcagct
gttgatggggctaggaaagctaacagtactcgaacatggaaagaggtctgcttcgcctgt
gtagatgggaaagaattccgtcttgctcagatgtgtggacttcatattgttgtacatgca
gatgaattagaagaacttatcaactactatcaggatcgtggctattttgaagagctgatc
accatgttggaagcagcactgggacttgagcgagctcacatgggaatgtttactgaatta
gctattctatactctaaatttaagcctcagaaaatgagggagcacctggagctgttctgg
tctagagtgaatattcccaaggtgctaagagctgcagaacaagctcatctttgggcagaa
ctggtgtttttgtatgacaagtatgaagaatatgataatgccataattaccatgatgaat
catccaactgatgcctggaaagaagggcaattcaaagatatcattaccaaggttgccaat
gtggaactatactacagagcaatacagttctacttagaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccacggttggatcacactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccgtatttgcgttcagttcagaaccataacaac
aaatctgtgaatgaatcattgaacaatctttttattacagaagaagattatcaggctctg
cgaacatcaatagatgcttatgacaactttgacaatatctcgcttgctcagcgtttggaa
aaacatgaactcattgagttcaggagaattgctgcttatctcttcaaaggcaacaatcgc
tggaaacagagtgtagagctgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcttctgaatctaaagatactgaattggctgaagaactcctgcagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctgtttacctgttacgatcttttaaggccagat
gtcgtcctagaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggagtacttgacaaaggtggataaattagatgcttcagaatcactgaga
aaagaagaagaacaagctacagagacacaacccattgtttatggtcagccccagttgatg
ctgacagcaggacccagtgttgccgtccctccccaggcaccttttggttatggttatacc
gcaccaccgtatggacagccacagcctggctttgggtacagcatgtga

KEGG   Homo sapiens (human): 8218Help
Entry
8218              CDS       T01001                                 

Gene name
CLTCL1, CHC22, CLH22, CLTCL, CLTD
Definition
(RefSeq) clathrin heavy chain like 1
  KO
K04646  clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8218 (CLTCL1)
   04142 Lysosome
    8218 (CLTCL1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    8218 (CLTCL1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    8218 (CLTCL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    8218 (CLTCL1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    8218 (CLTCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8218 (CLTCL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8218 (CLTCL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    8218 (CLTCL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   8218 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD
Motif
Other DBs
NCBI-GeneID: 8218
NCBI-ProteinID: NP_009029
OMIM: 601273
HGNC: 2093
Ensembl: ENSG00000070371
Vega: OTTHUMG00000150109
Pharos: P53675(Tbio)
UniProt: P53675
Position
22q11.21
AA seq 1640 aa AA seqDB search
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLE
KHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLVFDFDGHE
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctgttcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacattggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaagtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggtgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctgctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgctgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtagatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctgcatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtactgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtacttcggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccatctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcgaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctg
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcatgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacaaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctatatttataccgcaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgattggagggctgctt
gatgtggattgttctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccagattcaggaaggctgtgaggagcctgccactcacaatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtatgcagaaaggatccggagctctgggctcacgtcctt
gaggagaccaacccatccaggagacagctaattgaccaggtggtacagacagcattgtca
gaaacacgggatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagcgag
cacaggaatctacagaatctgttgatcctgactgccatcaaggcagaccgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcactggacatcgcgagcatcgctgtc
agcagcgcactgtatgaggaggccttcaccgttttccacaagtttgatatgaatgcctca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcatatgagtttgcggag
agatgcaatgagcctgctgtgtggagtcagctggcccaagcccagctccagaaagatttg
gtgaaggaagccatcaactcctatatcagaggggacgacccttcctcttacctggaagtt
gttcagtcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatttttgccttggctaaaacc
agccgtgtttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
atggatggacaagagttccgcttcgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
ttgctgttggaagcggccctgggcctggagcgggcccacatgggcatgttcactgagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtatgacaatgctgtgctcaccatgatgagc
caccccactgaggcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctttcaccccggctggaccacacctggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaaccacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcagctggag
aagcatcagctgatggagttcaggtgcattgcggcctatctgtacaagggcaataactgg
tgggcccagagcgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gctgcagagtcgcgggatgctgagctggcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgcttcgcagcttgtctcttcacctgctatgacctgcttcgcccagac
atggtgcttgagctggcctggaggcacaacctcgtggacttggccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacaaactggatgccttggagagtctgcgc
aagcaagaggagcatgtgacagagcctgcccctctcgtgtttgattttgatgggcatgaa
tga

DBGET integrated database retrieval system