KEGG   Homo sapiens (human): 121130
Entry
121130            CDS       T01001                                 

Gene name
OR10P1, OR10P1P, OR10P2P, OR10P3P, OR12-7, OST701
Definition
(RefSeq) olfactory receptor family 10 subfamily P member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    121130 (OR10P1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    121130 (OR10P1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    121130 (OR10P1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 121130
NCBI-ProteinID: NP_996782
HGNC: 15378
Ensembl: ENSG00000175398
Vega: OTTHUMG00000169961
Pharos: Q8NGE3(Tdark)
UniProt: Q8NGE3
Position
12q13.2
AA seq 313 aa
MAGENHTTLPEFLLLGFSDLKALQGPLFWVVLLVYLVTLLGNSLIILLTQVSPALHSPMY
FFLRQLSVVELFYTTDIVPRTLANLGSPHPQAISFQGCAAQMYVFIVLGISECCLLTAMA
YDRYVAICQPLRYSTLLSPRACMAMVGTSWLTGIITATTHASLIFSLPFRSHPIIPHFLC
DILPVLRLASAGKHRSEISVMTATIVFIMIPFSLIVTSYIRILGAILAMASTQSRRKVFS
TCSSHLLVVSLFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR
ALRHLVKRQRPSP
NT seq 942 nt   +upstreamnt  +downstreamnt
atggctggggaaaaccatactacactgcctgaattcctccttctgggattctctgacctc
aaggccctgcagggccccctgttctgggtggtgcttctggtctacctggtcaccttgctg
ggtaactccctgatcatcctcctcacacaggtcagccctgccctgcactcccccatgtac
ttcttcctgcgccaactctcagtggtggagctcttctacaccactgacatcgtgcccagg
accctggccaatctgggctccccgcatccccaggccatctctttccagggctgtgcagcc
cagatgtacgtcttcattgtcctgggcatctcggagtgctgcctgctcacggccatggcc
tatgaccgatatgttgccatctgccagcccctacgctattccaccctcttgagcccacgg
gcctgcatggccatggtgggtacctcctggctcacaggcatcatcacggccaccacccat
gcctccctcatcttctctctaccttttcgcagccacccgatcatcccgcactttctctgt
gacatcctgccagtactgaggctggcaagtgctgggaagcacaggagcgagatctccgtg
atgacagccaccatagtcttcattatgatccccttctctctgattgtcacctcttacatc
cgcatcctgggtgccatcctagcaatggcctccacccagagccgccgcaaggtcttctcc
acctgctcctcccatctgctcgtggtctctctcttctttggaacagccagcatcacctac
atccggccgcaggcaggctcctctgttaccacagaccgcgtcctcagtctcttctacaca
gtcatcacacccatgctcaaccccatcatctacacccttcggaacaaggacgtgaggagg
gccctgcgacacttggtgaagaggcagcgcccctcaccctga

DBGET integrated database retrieval system