KEGG   Homo sapiens (human): 1212Help
Entry
1212              CDS       T01001                                 

Gene name
CLTB, LCB
Definition
(RefSeq) clathrin light chain B
  KO
K04645  clathrin light chain B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1212 (CLTB)
   04142 Lysosome
    1212 (CLTB)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1212 (CLTB)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1212 (CLTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1212 (CLTB)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1212 (CLTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1212 (CLTB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    1212 (CLTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q
Motif
Other DBs
NCBI-GeneID: 1212
NCBI-ProteinID: NP_009028
OMIM: 118970
HGNC: 2091
Ensembl: ENSG00000175416
Vega: OTTHUMG00000130662
Pharos: P09497(Tbio)
UniProt: P09497
Position
5q35.2
AA seq 229 aa AA seqDB search
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT
SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgactttggcttcttctcgtcgtcggagagcggtgccccggaggcggcggag
gaggacccggcggccgccttcctggcccagcaggagagcgagattgcaggcatagagaac
gacgagggcttcggggcacctgccggcagccatgcggcccccgcgcagccgggccccacg
agtggggctggttctgaggacatggggaccacagtcaatggagatgtgtttcaggaggcc
aacggtcctgctgatggctacgcagccattgcccaggctgacaggctgacccaggagcct
gagagcatccgcaagtggcgagaggagcagaggaaacggctgcaagagctggatgctgca
tctaaggtcacggaacaggaatggcgggagaaggccaagaaggacctggaggagtggaac
cagcgccagagtgaacaagtagagaagaacaagatcaacaaccggatcgctgacaaagca
ttctaccagcagccagatgctgatatcatcggctacgtggcatccgaggaggctttcgtg
aaggaatccaaggaggagaccccaggcacagagtgggagaaggtggcccagctatgtgac
ttcaaccccaagagcagcaagcagtgcaaagatgtgtcccgcctgcgctcggtgctcatg
tccctgaagcagacgccactgtcccgctag

DBGET integrated database retrieval system