KEGG   Homo sapiens (human): 121355
Entry
121355            CDS       T01001                                 

Gene name
GTSF1, Cue110, FAM112B
Definition
(RefSeq) gametocyte specific factor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-U11-48K zf-TRAF_2
Other DBs
NCBI-GeneID: 121355
NCBI-ProteinID: NP_653195
OMIM: 617484
HGNC: 26565
Ensembl: ENSG00000170627
Vega: OTTHUMG00000169842
Pharos: Q8WW33(Tdark)
UniProt: Q8WW33 A0A024RB57
Position
12q13.13
AA seq 167 aa
MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVP
RAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFV
WGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaagaaacttacaccgactccctggaccctgagaagctattgcaatgcccctatgac
aaaaaccatcaaatcagggcttgcaggtttccttatcatcttatcaagtgcagaaagaat
catcctgatgttgcaagcaaattggctacttgtcccttcaatgctcgccaccaggttcct
cgagctgaaattagtcatcatatctcaagctgtgatgacagaagttgtattgagcaagat
gttgtcaaccaaaccaggagccttagacaagagactctggctgagagcacttggcagtgc
cctccttgcgatgaagactgggataaagatttgtgggagcagaccagcaccccatttgtc
tggggcacaactcactactctgacaacaacagccctgcgagcaacatagttacagaacat
aagaataacctggcttcaggcatgcgagttcccaaatctctgccgtatgttctgccatgg
aaaaacaatggaaatgcacagtaa

DBGET integrated database retrieval system