KEGG   Homo sapiens (human): 121391Help
Entry
121391            CDS       T01001                                 

Gene name
KRT74, ADWH, HTSS2, HYPT3, K6IRS4, KRT5C, KRT6IRS4
Definition
(RefSeq) keratin 74
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00649  Ectodermal dysplasia, hair-nail type
H00667  Woolly hair
H00786  Hereditary hypotrichosis simplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    121391 (KRT74)
   04147 Exosome [BR:hsa04147]
    121391 (KRT74)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     121391 (KRT74)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   121391 (KRT74)
  Exosomal proteins of other body fluids (saliva and urine)
   121391 (KRT74)
  Exosomal proteins of colorectal cancer cells
   121391 (KRT74)
  Exosomal proteins of bladder cancer cells
   121391 (KRT74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip DUF4407 TPR_MLP1_2 Spc7 Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 121391
NCBI-ProteinID: NP_778223
OMIM: 608248
HGNC: 28929
Ensembl: ENSG00000170484
Vega: OTTHUMG00000169658
Pharos: Q7RTS7(Tbio)
UniProt: Q7RTS7
Position
12q13.13
AA seq 529 aa AA seqDB search
MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSLYSLGGNRRIS
FNVAGGGVRAGGYGFRPGSGYGGGRASGFAGSMFGSVALGPACLSVCPPGGIHQVTVNKS
LLAPLNVELDPEIQKVRAQEREQIKVLNDKFASFIDKVRFLEQQNQVLETKWELLQQLDL
NNCKKNLEPILEGYISNLRKQLETLSGDRVRLDSELRSMRDLVEDYKKRYEVEINRRTTA
ENEFVVLKKDADAAYAVKVELQAKVDSLDKEIKFLKCLYDAEIAQIQTHASETSVILSMD
NNRDLDLDSIIAEVRMHYEEIALKSKAEAEALYQTKIQELQLAASRHGDDLKHTRSEMVE
LNRLIQRIRCEIGNVKKQRASLETAIADAEQRGDNALKDAQAKLDELEGALHQAKEELAR
MLREYQELMSLKLALDMEIATYRKLLEGEECRMSGENPSSVSISVISSSSYSYHHPSSAG
VDLGASAVAGSSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcaactgaacatcaagtccagtggtgacaagggcaacttcagtgtgcattcg
gcagtggtgccaaggaaggctgtgggtagcctggcttcttactgtgcagctggcagaggg
gctggcgctggctttggcagtcggagcctctatagccttggagggaatcggcgtatttct
ttcaatgtggctggtggcggcgttcgggctggaggttacggcttcaggcctggctctggg
tatggagggggccgggccagtggctttgctggcagtatgtttggcagtgtggccctgggg
cctgcatgtttgtctgtgtgcccacctgggggcatccaccaggtcactgtcaacaagagc
ctcttggcccccctcaacgtggagctggaccctgagatccagaaggtgcgcgcccaggag
cgggaacagatcaaggtgctgaacgacaagttcgcctccttcattgacaaggtacgcttc
ctagagcagcagaaccaggttctagaaaccaagtgggagctgctgcagcagctggacctg
aacaactgcaagaagaacctggagcccatccttgagggctacatcagcaacctgcggaag
cagctggagacactgtctggggacagggtgaggctggactcggagctgagaagcatgagg
gatctggtggaggactataagaagagatatgaagtggagattaaccggcgcacgacagca
gagaatgagtttgtggtgcttaagaaggatgcagatgcagcctacgcagtcaaggtggag
cttcaggccaaagtggactcactggacaaagaaatcaagttcctcaagtgtctgtatgat
gcagagatcgctcagatccagactcacgccagtgagacctctgtcatcctgtccatggac
aacaaccgggacctggaccttgacagcatcatcgctgaggtccgcatgcattatgaggag
atcgccctgaagagcaaggccgaggccgaggccctgtaccagaccaagatccaggagctg
cagctggcagccagtcggcatggtgacgacctgaaacacaccaggagcgagatggtggag
ctgaaccggctcatccagaggatccggtgtgagatcgggaatgtgaagaagcagcgtgcc
agcctggagacggccatcgctgacgctgagcagcggggagacaatgccctgaaggatgcc
caggccaagctggatgagctggagggcgccctgcaccaggccaaggaggagctggcgcgg
atgctgcgcgagtaccaggagctcatgagcctgaaactggccctggacatggagattgcc
acctaccgcaagctgctggagggcgaggagtgcaggatgtctggtgagaatccatcctct
gtgagcatctctgtcatcagcagtagcagctacagctaccaccaccccagctctgcgggt
gttgaccttggggccagcgctgtggcaggcagctctggcagcacccagagcgggcagacc
aagaccacagaggcgcgagggggagacctcaaggacacccagggcaagagcaccccagcc
agcatcccagcaaggaaagccacccgctag

DBGET integrated database retrieval system