KEGG   Homo sapiens (human): 1215Help
Entry
1215              CDS       T01001                                 

Gene name
CMA1, CYH, MCT1, chymase
Definition
(RefSeq) chymase 1
  KO
K01329  chymase [EC:3.4.21.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    1215 (CMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1215 (CMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     1215 (CMA1)
Peptidases and inhibitors [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1215 (CMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 1215
NCBI-ProteinID: NP_001827
OMIM: 118938
HGNC: 2097
Ensembl: ENSG00000092009
Vega: OTTHUMG00000140181
Pharos: P23946(Tchem)
UniProt: P23946 Q4FEB3
Structure
PDB: 

Position
14q12
AA seq 247 aa AA seqDB search
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcttcctctccccctgctgctctttctcttgtgctccagagctgaagctggg
gagatcatcgggggcacagaatgcaagccacattcccgcccctacatggcctacctggaa
attgtaacttccaacggtccctcaaaattttgtggtggtttccttataagacggaacttt
gtgctgacggctgctcattgtgcaggaaggtctataacagtcacccttggagcccataac
ataacagaggaagaagacacatggcagaagcttgaggttataaagcaattccgtcatcca
aaatataacacttctactcttcaccacgatatcatgttactaaagttgaaggagaaagcc
agcctgaccctggctgtggggacactccccttcccatcccaattcaactttgtcccacct
gggagaatgtgccgggtggctggctggggaagaacaggtgtgttgaagccgggctcagac
actctgcaagaggtgaagctgagactcatggatccccaggcctgcagccacttcagagac
tttgaccacaatcttcagctgtgtgtgggcaatcccaggaagacaaaatctgcatttaag
ggagactctgggggccctcttctgtgtgctggggtggcccagggcatcgtatcctatgga
cggtcggatgcaaagccccctgctgtcttcacccgaatctcccattaccggccctggatc
aaccagatcctgcaggcaaattaa

DBGET integrated database retrieval system