KEGG   Homo sapiens (human): 121504
Entry
121504            CDS       T01001                                 

Gene name
H4-16, H4/p, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, HIST4H4
Definition
(RefSeq) H4 histone 16
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    121504 (H4-16)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    121504 (H4-16)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    121504 (H4-16)
  09165 Substance dependence
   05034 Alcoholism
    121504 (H4-16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    121504 (H4-16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    121504 (H4-16)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 121504
NCBI-ProteinID: NP_778224
OMIM: 615069
HGNC: 20510
Ensembl: ENSG00000197837
Vega: OTTHUMG00000168735
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
12p12.3
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctgggcgaggtaaaggtggcaaggggctgggtaagggaggcgccaagcgccaccgg
aaggtgctgcgggacaatatccaaggcattacaaagccggcgattcgccgtctcgcccga
cgtgggggcgtcaagcgcatttctggtctcatctacgaggagacccggggagtcctcaaa
gtcttcctggagaacgtgatccgtgacgcggtgacttacacggagcacgccaagcgcaag
accgtcacggccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctttatggt
ttcggcggttga

DBGET integrated database retrieval system