KEGG   Homo sapiens (human): 121504
Entry
121504            CDS       T01001                                 

Gene name
H4-16, H4/p, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, HIST4H4
Definition
(RefSeq) H4 histone 16
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    121504 (H4-16)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    121504 (H4-16)
  09165 Substance dependence
   05034 Alcoholism
    121504 (H4-16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    121504 (H4-16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    121504 (H4-16)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 121504
NCBI-ProteinID: NP_778224
OMIM: 615069
HGNC: 20510
Ensembl: ENSG00000197837
Vega: OTTHUMG00000168735
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
12p12.3
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctgggcgaggtaaaggtggcaaggggctgggtaagggaggcgccaagcgccaccgg
aaggtgctgcgggacaatatccaaggcattacaaagccggcgattcgccgtctcgcccga
cgtgggggcgtcaagcgcatttctggtctcatctacgaggagacccggggagtcctcaaa
gtcttcctggagaacgtgatccgtgacgcggtgacttacacggagcacgccaagcgcaag
accgtcacggccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctttatggt
ttcggcggttga

KEGG   Homo sapiens (human): 554313
Entry
554313            CDS       T01001                                 

Gene name
H4C15, H4-16, H4/o, H4C1, H4C11, H4C12, H4C13, H4C14, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, HIST2H4B
Definition
(RefSeq) H4 clustered histone 15
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    554313 (H4C15)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    554313 (H4C15)
  09165 Substance dependence
   05034 Alcoholism
    554313 (H4C15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    554313 (H4C15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    554313 (H4C15)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 554313
NCBI-ProteinID: NP_001029249
HGNC: 29607
Ensembl: ENSG00000270276
Vega: OTTHUMG00000188201
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
1q21.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

KEGG   Homo sapiens (human): 8294
Entry
8294              CDS       T01001                                 

Gene name
H4C9, H4-16, H4/m, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4FM, H4M, HIST1H4I
Definition
(RefSeq) H4 clustered histone 9
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8294 (H4C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8294 (H4C9)
  09165 Substance dependence
   05034 Alcoholism
    8294 (H4C9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8294 (H4C9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8294 (H4C9)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8294
NCBI-ProteinID: NP_003486
OMIM: 602833
HGNC: 4793
Ensembl: ENSG00000276180
Vega: OTTHUMG00000014471
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.1
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtcaggacgcggcaaaggaggtaagggcctggggaaagggggtgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggtatcaccaagccagccattcggcgccttgctcgc
cgcggcggcgtgaagcgcatttctggcctcatctatgaggagacccgcggagtgttgaag
gtgttcctggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag
acggtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc
ttcggcggctaa

KEGG   Homo sapiens (human): 8359
Entry
8359              CDS       T01001                                 

Gene name
H4C1, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, HIST1H4A
Definition
(RefSeq) H4 clustered histone 1
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8359 (H4C1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8359 (H4C1)
  09165 Substance dependence
   05034 Alcoholism
    8359 (H4C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8359 (H4C1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8359 (H4C1)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8359
NCBI-ProteinID: NP_003529
OMIM: 602822
HGNC: 4781
Ensembl: ENSG00000278637
Vega: OTTHUMG00000014419
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggacgtggtaagggcgggaagggtttgggtaaggggggtgccaagcgccaccgc
aaggtgttgcgtgacaacatccagggcatcaccaagccggccatccggcgtctggcccgg
cgtggcggtgtgaagcggatctctggtctgatctacgaggagactcgcggggtgctcaag
gtgtttttggagaacgtgatccgtgacgctgtcacctatacggagcacgccaagcgcaag
acagtcactgccatggacgtggtctacgcgcttaagcgccagggacgcaccctttatggc
tttggcggttaa

KEGG   Homo sapiens (human): 8360
Entry
8360              CDS       T01001                                 

Gene name
H4C4, H4-16, H4/b, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C5, H4C6, H4C8, H4C9, H4FB, HIST1H4D, dJ221C16.9
Definition
(RefSeq) H4 clustered histone 4
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8360 (H4C4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8360 (H4C4)
  09165 Substance dependence
   05034 Alcoholism
    8360 (H4C4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8360 (H4C4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8360 (H4C4)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8360
NCBI-ProteinID: NP_003530
OMIM: 602823
HGNC: 4782
Ensembl: ENSG00000277157
Vega: OTTHUMG00000014423
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggtaagggcggaaagggtctaggtaagggtggcgccaagcgtcaccgt
aaggtattgcgtgacaatatccaaggaatcaccaagcccgctatccgccgcctggctcgc
cgcggcggcgtcaagcgtatttctggcctcatttatgaggaaactcgcggagtgctgaaa
gttttcctggaaaatgtaatccgcgatgctgtcacctacacggaacacgccaaacgcaag
acagtcacagccatggacgtggtgtacgcgctcaagcgccagggacgcactctttatggc
ttcggcggctga

KEGG   Homo sapiens (human): 8361
Entry
8361              CDS       T01001                                 

Gene name
H4C6, H4, H4-16, H4/c, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C8, H4C9, H4FC, HIST1H4F
Definition
(RefSeq) H4 clustered histone 6
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8361 (H4C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8361 (H4C6)
  09165 Substance dependence
   05034 Alcoholism
    8361 (H4C6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8361 (H4C6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8361 (H4C6)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8361
NCBI-ProteinID: NP_003531
OMIM: 602824
HGNC: 4783
Ensembl: ENSG00000274618
Vega: OTTHUMG00000014443
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtagaggcaaaggtggtaaaggtttaggaaagggaggcgccaagcgccatcgc
aaagtgctgcgtgacaacatacagggcatcacgaagcccgccatccgtcgcttggcccga
cgcggcggcgtgaaacgcatttcgggcctcatttatgaggagacccgcggtgttcttaag
gtgttcctggagaatgtgatacgggacgccgtaacctacacggagcacgccaagcgtaag
acagtcactgcaatggatgttgtctacgcgctcaagcgccagggacgcactctgtacggc
tttggtggctga

KEGG   Homo sapiens (human): 8362
Entry
8362              CDS       T01001                                 

Gene name
H4C12, H4-16, H4/d, H4C1, H4C11, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2iii, H4FD, HIST1H4K, dJ160A22.1
Definition
(RefSeq) H4 clustered histone 12
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8362 (H4C12)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8362 (H4C12)
  09165 Substance dependence
   05034 Alcoholism
    8362 (H4C12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8362 (H4C12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8362 (H4C12)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8362
NCBI-ProteinID: NP_003532
OMIM: 602825
HGNC: 4784
Ensembl: ENSG00000273542
Vega: OTTHUMG00000014488
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.1
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

KEGG   Homo sapiens (human): 8363
Entry
8363              CDS       T01001                                 

Gene name
H4C11, H4-16, H4/e, H4C1, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2iv, H4FE, HIST1H4J, dJ160A22.2
Definition
(RefSeq) H4 clustered histone 11
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8363 (H4C11)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8363 (H4C11)
  09165 Substance dependence
   05034 Alcoholism
    8363 (H4C11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8363 (H4C11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8363 (H4C11)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8363
NCBI-ProteinID: NP_068803
OMIM: 602826
HGNC: 4785
Ensembl: ENSG00000197238
Vega: OTTHUMG00000014487
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.1
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

KEGG   Homo sapiens (human): 8364
Entry
8364              CDS       T01001                                 

Gene name
H4C3, H4-16, H4/g, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C4, H4C5, H4C6, H4C8, H4C9, H4FG, HIST1H4C, dJ221C16.1
Definition
(RefSeq) H4 clustered histone 3
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8364 (H4C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8364 (H4C3)
  09165 Substance dependence
   05034 Alcoholism
    8364 (H4C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8364 (H4C3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8364 (H4C3)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8364
NCBI-ProteinID: NP_003533
OMIM: 602827
HGNC: 4787
Ensembl: ENSG00000197061
Vega: OTTHUMG00000014429
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggaaaaggcttggggaagggtggtgctaagcgccatcgt
aaggtgctccgggataacatccagggcattacaaaaccggctattcgccgtttggctcgg
cgcggtggcgtcaagcgcatttccggtcttatctatgaggagactcgaggtgtgcttaag
gttttcttagagaacgttattcgagacgccgtcacctatacggagcacgccaagcgcaaa
actgtcacagccatggatgtagtatatgccctaaaacgtcaggggcgcactctgtatggc
ttcggcggctga

KEGG   Homo sapiens (human): 8365
Entry
8365              CDS       T01001                                 

Gene name
H4C8, H4-16, H4/h, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C9, H4FH, HIST1H4H
Definition
(RefSeq) H4 clustered histone 8
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8365 (H4C8)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8365 (H4C8)
  09165 Substance dependence
   05034 Alcoholism
    8365 (H4C8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8365 (H4C8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8365 (H4C8)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8365
NCBI-ProteinID: NP_003534
OMIM: 602828
HGNC: 4788
Ensembl: ENSG00000158406
Vega: OTTHUMG00000014454
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgtggtaaaggtggaaaaggtttgggtaagggaggagctaagcgtcatcgc
aaggttttgcgcgataacatccagggcatcactaagccagctatccggcgccttgctcgt
cgcggcggtgtcaagcgaatttctggccttatctatgaggagactcgtggtgttctgaag
gtgttcctggagaacgtgattcgtgacgctgtcacttacacagagcacgccaaacgcaag
accgtgacagcaatggatgtggtctacgcgctgaagcgacagggacgcactctttacggc
ttcggtggctaa

KEGG   Homo sapiens (human): 8366
Entry
8366              CDS       T01001                                 

Gene name
H4C2, H4-16, H4/I, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FI, HIST1H4B
Definition
(RefSeq) H4 clustered histone 2
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8366 (H4C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8366 (H4C2)
  09165 Substance dependence
   05034 Alcoholism
    8366 (H4C2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8366 (H4C2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8366 (H4C2)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8366
NCBI-ProteinID: NP_003535
OMIM: 602829
HGNC: 4789
Ensembl: ENSG00000278705
Vega: OTTHUMG00000014417
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggtaaaggtttgggtaagggaggtgccaagcgtcaccga
aaagtgctgcgggataacatccaaggcatcaccaaaccggccattcggcgccttgctagg
cgtggtggggttaagcgaatttccggtttgatttatgaggagactcgtggcgttctcaag
gtgtttctggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag
actgtcactgccatggatgtggtttacgcgctcaagcgtcaaggacgcactctgtacggc
ttcggcggttaa

KEGG   Homo sapiens (human): 8367
Entry
8367              CDS       T01001                                 

Gene name
H4C5, H4-16, H4/j, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C6, H4C8, H4C9, H4FJ, HIST1H4E
Definition
(RefSeq) H4 clustered histone 5
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8367 (H4C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8367 (H4C5)
  09165 Substance dependence
   05034 Alcoholism
    8367 (H4C5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8367 (H4C5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8367 (H4C5)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8367
NCBI-ProteinID: NP_003536
OMIM: 602830
HGNC: 4790
Ensembl: ENSG00000276966
Vega: OTTHUMG00000014441
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggaaagggactgggtaaaggaggcgctaagcgtcaccgt
aaggtcctgcgagataacatccagggcattaccaagcctgccatccggcgccttgctcgt
cgcgggggtgtcaagcgcatttctggtctcatctacgaggagactcgcggggttctgaag
gtgtttctggaaaacgtgattcgtgatgctgtgacttacacggagcacgccaaacgcaag
acagtgacagcgatggatgtggtctacgcgctgaagagacagggacgcactctttacggc
ttcggcggctaa

KEGG   Homo sapiens (human): 8368
Entry
8368              CDS       T01001                                 

Gene name
H4C13, H4-16, H4.k, H4/k, H4C1, H4C11, H4C12, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FK, HIST1H4L
Definition
(RefSeq) H4 clustered histone 13
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8368 (H4C13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8368 (H4C13)
  09165 Substance dependence
   05034 Alcoholism
    8368 (H4C13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8368 (H4C13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8368 (H4C13)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8368
NCBI-ProteinID: NP_003537
OMIM: 602831
HGNC: 4791
Ensembl: ENSG00000275126
Vega: OTTHUMG00000016211
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.1
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctgggcgcggcaaaggcgggaagggtctgggcaaaggaggcgctaagcgccaccgc
aaagttctgcgcgacaacattcagggcatcaccaagcccgccatccgacgcctggcacgg
cgtggaggcgttaagcgcatctcaggccttatatacgaggagacacgcggagttcttaaa
gtgtttttggagaatgtaatccgcgatgcagttacctacacggagcacgccaaacgcaag
acagtcacagccatggacgtggtttacgcgctcaagcgccagggccgcaccctgtatggc
tttggcggctga

KEGG   Homo sapiens (human): 8369
Entry
8369              CDS       T01001                                 

Gene name
H4C7, H4/l, H4FL, HIST1H4G
Definition
(RefSeq) H4 clustered histone 7
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8369 (H4C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8369 (H4C7)
  09165 Substance dependence
   05034 Alcoholism
    8369 (H4C7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8369 (H4C7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8369 (H4C7)
SSDB
Motif
Pfam: CENP-T_C
Other DBs
NCBI-GeneID: 8369
NCBI-ProteinID: NP_003538
OMIM: 602832
HGNC: 4792
Ensembl: ENSG00000275663
Vega: OTTHUMG00000014444
Pharos: Q99525(Tdark)
UniProt: Q99525
Position
6p22.2
AA seq 98 aa
MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFK
VFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtctgttcggggcaaggccggaaaaggccttgggaaaggcggtgccaagtgccatcgc
aaggtactgagcgataatattcagggcattaccaagtgcactatccggcgcttggcccgg
catggcggtgtcaagcgcatcttgggcctcatttatgaggagacccgccgggtgttcaag
gtgttcctggaaaatgtgatctggtacgccgtgaccaacacggagcacgccaagcgcaag
acggtcaccgccatggccgtggtctacgtgctcaaacgccagggaagaaccctgtaa

KEGG   Homo sapiens (human): 8370
Entry
8370              CDS       T01001                                 

Gene name
H4C14, FO108, H4, H4-16, H4/n, H4C1, H4C11, H4C12, H4C13, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, HIST2H4, HIST2H4A
Definition
(RefSeq) H4 clustered histone 14
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8370 (H4C14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8370 (H4C14)
  09165 Substance dependence
   05034 Alcoholism
    8370 (H4C14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8370 (H4C14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8370 (H4C14)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8370
NCBI-ProteinID: NP_003539
OMIM: 142750
HGNC: 4794
Ensembl: ENSG00000270882
Vega: OTTHUMG00000012189
Pharos: P62805(Tbio)
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
1q21.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system