KEGG   Homo sapiens (human): 121549
Entry
121549            CDS       T01001                                 

Gene name
ASCL4, ASH-4, HASH4, bHLHa44
Definition
(RefSeq) achaete-scute family bHLH transcription factor 4
  KO
K09067  achaete-scute complex protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    121549 (ASCL4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    121549 (ASCL4)
SSDB
Motif
Pfam: HLH Cas9-BH
Other DBs
NCBI-GeneID: 121549
NCBI-ProteinID: NP_982260
OMIM: 609155
HGNC: 24311
Ensembl: ENSG00000187855
Vega: OTTHUMG00000156964
Pharos: Q6XD76(Tdark)
UniProt: Q6XD76
Position
12q23.3
AA seq 172 aa
METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQY
LPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDY
IKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggagacgcgtaaaccggcggaacggctggccttgccatactcgctgcgcaccgcgccc
ctgggcgttccggggaccctgcccggactcccgcggagggaccccctcagggtcgccctg
cgtctggacgccgcgtgctgggagtgggcgcgcagcggctgcgcacggggatggcagtac
ttgcccgtgccgctggacagcgccttcgagcccgccttcctccgcaagcgcaacgagcgc
gagcggcagcgggtgcgctgcgtgaacgagggctatgcgcgcctccgagaccacctgccc
cgggagctggcagacaagcgcctcagcaaagtggagacgctccgcgctgccatcgactac
atcaagcacctgcaggagctgctggagcgccaggcctgggggctcgagggcgcggccggc
gccgtcccccagcgcagggcggaatgcaacagcgacggggagtccaaggcctcttcggcg
ccttcgcccagcagcgagcccgaggaggggggcagctag

DBGET integrated database retrieval system