KEGG   Homo sapiens (human): 121643
Entry
121643            CDS       T01001                                 
Symbol
FOXN4
Name
(RefSeq) forkhead box N4
  KO
K09407  forkhead box protein N
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    121643 (FOXN4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    121643 (FOXN4)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 121643
NCBI-ProteinID: NP_998761
OMIM: 609429
HGNC: 21399
Ensembl: ENSG00000139445
Pharos: Q96NZ1(Tbio)
UniProt: Q96NZ1 A6H901
Position
12:complement(109277978..109309284)
AA seq 517 aa
MIESDTSSIMSGIIRNSGQNHHPSPQEYRLLATTSDDDLPGDLQSLSWLTAVDVPRLQQM
ASGRVDLGGPCVPHPHPGALAGVADLHVGATPSPLLHGPAGMAPRGMPGLGPITGHRDSM
SQFPVGGQPSSGLQDPPHLYSPATQPQFPLPPGAQQCPPVGLYGPPFGVRPPYPQPHVAV
HSSQELHPKHYPKPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKTAPDGWKNS
VRHNLSLNKCFEKVENKMSGSSRKGCLWALNLARIDKMEEEMHKWKRKDLAAIHRSMANP
EELDKLISDRPESCRRPGKPGEPEAPVLTHATTVAVAHGCLAVSQLPPQPLMTLSLQSVP
LHHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINISTDMNTEVDA
LDPSIMDFALQGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ
VTGLYTAYSTPDSVAASGTSSSSQYLGAQGNKPIALL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgatagaaagtgacacctcatccataatgtcaggaattattcgaaactcagggcaaaat
caccacccctctccacaggaatacaggcttctagccaccaccagcgatgatgaccttccc
ggggacctgcagtcgctgtcgtggctcacggcggtggatgtgcctcggctgcagcagatg
gcaagtggccgcgtggacctgggtggcccctgcgtgccacatccacacccaggtgccttg
gctggggtggccgacctgcatgtgggagccactccaagtccccttctccatggcccagca
ggcatggccccccgaggcatgccaggtctgggccccataactggccacagagacagcatg
agccagttccccgtggggggccagccctcatctggcctgcaggacccgccgcatctgtac
tcacctgccacccaaccacagttcccgctccccccgggtgcccagcagtgccctcctgtg
ggcctctatggccccccatttggggtgcggcccccctacccccagccccacgtggctgtg
cattcatctcaagaactgcaccccaaacactaccccaagcccatctactcgtacagctgt
ctgatcgccatggccctgaagaacagcaagacaggcagcctgcctgtgagcgagatctac
agcttcatgaaggagcacttcccctacttcaagacggcccccgacgggtggaagaactcg
gtgcggcacaacctgtctctgaacaagtgcttcgagaaggtggagaacaagatgagcggc
tcctcccgcaagggctgcctgtgggctctgaacctggcccgcatcgacaagatggaggag
gagatgcacaagtggaagaggaaggacctggctgccatccaccggagtatggccaaccct
gaggagttggacaagctgatctccgaccggcctgaaagctgccggcgccccggcaaaccg
ggggaaccagaggcccccgtgctgactcacgccaccacagtggccgtggcgcatggctgc
ctggctgtctcccagctcccaccccagccactgatgaccctgtccctgcagtcagtcccc
ctgcaccaccaggtccagccccaggcacatcttgctccagactctccagcaccagcccag
accccgccactgcacgccctgccggacctcagccccagcccgctcccccaccccgccatg
ggaagggctcctgtagacttcatcaacatcagcaccgacatgaacactgaggtggatgcc
ctcgacccgagcatcatggacttcgctctgcaggggaacctgtgggaggagatgaaggat
gagggattcagcttggacacactgggcgcctttgcagactccccgcttggctgtgacctg
ggggcctcaggcctaacccctgcctcgggtggcagcgaccagtccttcccagacttgcag
gtgacgggtctctacacagcgtactccactccggacagtgtggctgcatcgggcaccagc
tcctcctcccagtacctgggtgcacaggggaacaagcctatagccctgctttga

DBGET integrated database retrieval system