KEGG   Homo sapiens (human): 122011Help
Entry
122011            CDS       T01001                                 

Gene name
CSNK1A1L, CK1
Definition
(RefSeq) casein kinase 1 alpha 1 like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05010  Alzheimer disease
hsa05165  Human papillomavirus infection
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    122011 (CSNK1A1L)
   04340 Hedgehog signaling pathway
    122011 (CSNK1A1L)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    122011 (CSNK1A1L)
   05226 Gastric cancer
    122011 (CSNK1A1L)
   05224 Breast cancer
    122011 (CSNK1A1L)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122011 (CSNK1A1L)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    122011 (CSNK1A1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    122011 (CSNK1A1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     122011 (CSNK1A1L)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   122011 (CSNK1A1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal ABC1 Pox_ser-thr_kin APH Kdo
Motif
Other DBs
NCBI-GeneID: 122011
NCBI-ProteinID: NP_660204
HGNC: 20289
Ensembl: ENSG00000180138
Vega: OTTHUMG00000016748
Pharos: Q8N752(Tdark)
UniProt: Q8N752
Position
13q13.3
AA seq 337 aa AA seqDB search
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYE
SKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKH
LIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaacagcggctccaaagccgaactcgttgtgggagggaaatacaaactggtg
cggaagatcgggtctggctcctttggagacgtttatctgggcatcaccaccaccaacggc
gaggacgtagcagtgaagctggaatctcagaaggtcaagcacccccagttgctgtatgag
agcaaactctacacgattcttcaaggtggggttggcatcccccacatgcactggtatggt
caggaaaaagacaacaatgtgctagtcatggaccttctgggacccagcctcgaagacctc
tttaatttctgttcaagaaggttcaccatgaaaactgtacttatgttagccgaccagatg
atcagcagaattgaatacgtgcatacaaagaattttctacaccgagacattaaaccagat
aacttcctgatgggtactgggcgtcactgtaataagttgttccttattgattttggtttg
gccaaaaagtacagagacaacaggaccaggcaacacataccgtacagagaagataaacac
ctcattggcactgtccgatatgccagcatcaatgcacatcttggtattgagcagagccgc
cgagatgacatggaatccttaggctacgttttcatgtattttaatagaaccagcctgccg
tggcaaggactaagggctatgacaaaaaaacaaaaatatgaaaagattagtgagaagaag
atgtccacccctgttgaagttttatgtaaggggtttcctgcagaattcgccatgtacttg
aactactgtcgtgggctgcgctttgaggaagtcccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccaccaatatgactacacatttgattggacgatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccagacaggcaagcaaactgaaaaaaacaagaataatgtgaaagataactaa

DBGET integrated database retrieval system