KEGG   Homo sapiens (human): 122416Help
Entry
122416            CDS       T01001                                 

Gene name
ANKRD9
Definition
(RefSeq) ankyrin repeat domain 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_4 Ank_3 Ank_2 Ank
Motif
Other DBs
NCBI-GeneID: 122416
NCBI-ProteinID: NP_001335580
OMIM: 618605
HGNC: 20096
Ensembl: ENSG00000156381
Vega: OTTHUMG00000171777
Pharos: Q96BM1(Tdark)
UniProt: Q96BM1
Position
14q32.31
AA seq 317 aa AA seqDB search
MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFH
WDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALA
VRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLG
HGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTP
VGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALD
ELPLPPFLQPLDLTGKG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgggacgcgcggcggcctgggggtggcgcggacggcgggcccgaggcctcgggc
gcggcgcgctcgcgagcgcagaagcagtgccgcaagtcgtcgttcgccttctaccaggcg
gtgcgcgacctgctacccgtgtggctgctggaggatatgcgcgccagcgaggccttccac
tgggacgagcgcgggcgcgccgccgcctactcgccctctgaggcgctgctctacgcgctc
gtgcacgaccaccaagcgtacgcgcattacctgctggccacgttcccgcggcgcgcgctc
gcaccgcccagtgccggcttccgctgctgcgcggctcccgggccgcacgtggcgctggca
gtgcgctacaaccgcgtgggcattctgcgccgcatcctgcgcaccttgcgcgacttcccg
gccgaggagcgggcgcgcgtgctggaccggcgtggctgcagccgcgtggagggcggtggc
acgtcgctgcacgtggcctgtgagctggcgcgccccgagtgcctcttcctgctgctgggc
cacggcgcctcgcccggtctgcgggacggcggcggcctcacgcctctcgagctgctgctg
cgccagctgggccgcgacgccggggccactccctccgccgccggagcccccgcctcagct
cccggggagccgcgccagcgccgcctgctgctgctggacctcctggcgctgtacaccccc
gtgggtgccgccggctcggcccgccaggagctgctgggcgaccggccgcgctggcagcgg
ctgctgggtgaggacaagttccagtggctggcgggcctggcgccgccctcgctcttcgcg
cgcgccatgcaggtgctggtcaccgccatctctccaggccgcttccccgaggccctggac
gagctgccgctgcccccattcctgcagccgttggacctcactggcaaaggctag

DBGET integrated database retrieval system