KEGG   Homo sapiens (human): 122481Help
Entry
122481            CDS       T01001                                 

Gene name
AK7, AK_7, CFAP75, FAP75, SPGF27
Definition
(RefSeq) adenylate kinase 7
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    122481 (AK7)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    122481 (AK7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    122481 (AK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     122481 (AK7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   122481 (AK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dpy-30 ADK AAA_18 AAA_17 AAA Hydin_ADK AAA_16 Epimerase AAA_28 AAA_24 MMR_HSR1 KTI12 Cytidylate_kin RIIa Mlh1_C
Motif
Other DBs
NCBI-GeneID: 122481
NCBI-ProteinID: NP_689540
OMIM: 615364
HGNC: 20091
Ensembl: ENSG00000140057
Vega: OTTHUMG00000171421
Pharos: Q96M32(Tbio)
UniProt: Q96M32
Position
14q32.2
AA seq 723 aa AA seqDB search
MAEEEETAALTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNIT
ESSQQMEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGKKARKFAAYVVAAGLQYGAEGGMLHTFFKMAWLGEIPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGK
IQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYK
QSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE
GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYIL
DGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPE
SIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ
LIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNK
RLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNP
EAQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaagaggaaactgctgctctcacggagaaggttatccggacccagagggtg
tttataaacctgttggattcctacagcagcggaaacatcgggaagtttctatctaactgt
gtagttggggcttcgcttgaagaaattacagaggaagaggaagaggaagatgaaaataag
tcagctatgctggaagcttcctcaaccaaagtgaaggaaggcacattccagattgtgggc
acgctgtccaagcctgacagcccgcggcctgactttgcggtggagacgtactctgccatc
tctcgagaagaccttctcatgcgcctgctggagtgtgatgttattatttataacatcact
gagagctcacagcaaatggaggaagccatctgggcagtctctgcactcagtgaagaagtc
agccactttgaaaagcgaaagctatttattttactgtcgacggtgatgacttgggcgcgc
tccaaagccctggaccccgaggattctgaggttccattcactgaagaagattatcgaaga
agaaagtctcatcctaattttctggaccacataaatgctgaaaaaatggttctcaaattt
ggaaaaaaggccagaaaatttgcagcatacgtagttgctgctggactccagtatggagcg
gaaggaggcatgttacacacattttttaagatggcttggttgggcgagattcctgcatta
ccagtttttggcgatggaacaaatgtaattccaacaatccatgttcttgatctagcagga
gtgatacaaaacgtcatagatcacgtgccaaagcctcactacctggttgctgtggatgag
tctgttcataccctggaagacatagtcaagtgtatcagtaaaaatactggccctgggaaa
atccagaaaatacccagagaaaatgcatacctaaccaaggacttaacgcaagattgtctt
gaccatttactggtcaacttaagaatggaagcgctctttgtgaaggagaattttaatatt
cgatgggctgcccaaacaggatttgtggaaaatatcaacactatcctcaaggagtacaag
caaagcagaggattgatgccaatcaagatctgcattcttggtccccctgctgtgggaaaa
tccagtattgctaaagaattggccaactactacaaactgcatcacatccaactgaaggat
gtcatttctgaagccatagcaaaactggaggcgattgttgcccctaacgatgtaggggaa
ggagaagaagaagtcgaagaggaagaggaggaggagaatgtggaagatgcacaggagctc
ctagatggcatcaaggagagcatggagcagaatgcaggtcaactagacgatcaatatata
attagatttatgaaagaaaagctaaaatcaatgccttgcaggaatcaaggttatattttg
gatggattcccaaagacctatgatcaagcaaaagacctgttcaatcaggaagatgaggag
gaggaagatgatgtcagaggcagaatgtttccctttgataaattaattatacctgaattc
gtttgtgcactggatgcttcggatgagtttctgaaggagcgtgtgataaaccttcctgag
agcatcgtggcggggacccactacagccaagaccgattcctccgggctctgagcaactac
cgggacatcaatatcgacgatgagactgtcttcaactattttgatgaacttgaaattcac
ccgatacatattgatgtaggaaaacttgaagatgctcagaatagacttgctatcaaacag
ctcatcaaagagattggggagcctcgaaattatggtttaacagacgaagaaaaggcagaa
gaggagcggaaggctgcggaggagcggctggccagggaggctgctgaggaagcagaacgc
gagcaccaggaggccgtggagatggcagagaagatagctcgctgggaggagtggaataaa
cgactggaggaagtgaaaagagaagaaagagaattactggaggctcagtcaattcccctg
agaaactatttaatgacctatgtgatgccaactcttattcagggcctgaatgaatgttgc
aacgtccgacccgaagaccctgttgattttctggcagaatatctcttcaagaacaatcct
gaagcacagtga

DBGET integrated database retrieval system