KEGG   Homo sapiens (human): 122553Help
Entry
122553            CDS       T01001                                 

Gene name
TRAPPC6B, NEDMEBA, TPC6
Definition
(RefSeq) trafficking protein particle complex 6B
  KO
K20304  trafficking protein particle complex subunit 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    122553 (TRAPPC6B)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    122553 (TRAPPC6B)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    122553 (TRAPPC6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAPP
Motif
Other DBs
NCBI-GeneID: 122553
NCBI-ProteinID: NP_001073005
OMIM: 610397
HGNC: 23066
Ensembl: ENSG00000182400
Vega: OTTHUMG00000140259
Pharos: Q86SZ2(Tdark)
UniProt: Q86SZ2
Structure
PDB: 

Position
14q21.1
AA seq 158 aa AA seqDB search
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKD
ELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLA
FTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaggcgttgtttttgcttctccataacgagatggtgtctggagtgtacaag
tccgcggagcagggggaggtggaaaacggacgatgtattactaagctggaaaacatgggg
tttcgagtgggacaaggattgatagaaaggtttacaaaagatactgcaaggttcaaggat
gagttagatatcatgaagttcatttgtaaagatttttggactacggtattcaagaaacaa
atcgacaatctaaggacaaatcatcagggcatctatgtacttcaggacaacaaatttcgc
ctgcttactcagatgtctgcaggaaaacagtatttagaacatgcatctaagtatttagca
tttacgtgtggcttaatcagaggtggcttatcaaacttgggaataaaaagtattgtaaca
gctgaagtgtcttcaatgcctgcttgcaaatttcaggtgatgatacagaagctgtag

DBGET integrated database retrieval system