KEGG   Homo sapiens (human): 122616
Entry
122616            CDS       T01001                                 
Symbol
CLBA1, C14orf79
Name
(RefSeq) clathrin binding box of aftiphilin containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Clathrin_bdg
Other DBs
NCBI-GeneID: 122616
NCBI-ProteinID: NP_777551
HGNC: 20126
Ensembl: ENSG00000140104
Pharos: Q96F83(Tdark)
UniProt: Q96F83
Position
14:104985788..105001274
AA seq 325 aa
MQGRRELGGEPLSDLQEEAASASLRVAPERLSDDSLEWRRTCPDLLLSDGKASISMPREG
GSTCTARCPDPGEHSSTWGEFEGFRESSAKSGQFSQSLELLEGPTEPQPPRTTSAPKECS
SHQPCQGGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEK
PGVERVHKLCNESRKLWRALQSIHTTSTSQRLWSESRCQENFFLVLGIDAAQKNLSGGQG
HIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQ
HITIPRKRMFTPRKLKLTLFNSDVC
NT seq 978 nt   +upstreamnt  +downstreamnt
atgcaaggccggcgggagctggggggagagcctttgagtgacctccaggaggaagcagcc
agcgcttccctccgagtggcacctgagaggctgagtgatgacagtttggaatggagacgg
acctgccccgaccttctcctgtccgatgggaaagccagcatctccatgccccgtgagggc
ggttccacctgcactgcccgatgtcctgaccctggggaacacagcagcacttggggggag
tttgaaggctttcgggaatcttcagccaagtctggacaattctcacagtcccttgaactc
ctcgagggacccacagaaccccagccaccgagaaccacttctgccccaaaagagtgcagt
tctcaccaaccatgccagggtggaccttgggtgacaggaacttctgccgtcccaccttct
gagcccattctcagctatgagaacattttaaagtgtgcttttcaagaaataacagtccag
caggcagctgaagacgtttccaccatagaccatttcctagaaataagcagtgaagaaaaa
cctggcgttgaacgtgtacataaattgtgtaacgaatccagaaaactctggagagccctt
cagagcatacacaccacgtctacttctcagcgcctctggagcgagtcccgttgccaggag
aacttctttcttgttctcggaatagatgctgcgcagaagaacctttctggaggccagggc
cacatcatggaagattgtgacctcaaagagcctgaaggactcctcactgtcagcagcttc
tgtctccagcattgcaaagccctgatccagaccaagctctcggggccgcctggcagcaaa
caggggaggctgatgacatgcagccgcttcctgaagaccccctcatgcggaggtggccag
cacatcactattccaaggaaaaggatgttcactccacgcaagctcaaactgacactcttt
aatagcgacgtttgctaa

DBGET integrated database retrieval system