KEGG   Homo sapiens (human): 122618
Entry
122618            CDS       T01001                                 

Gene name
PLD4, C14orf175
Definition
(RefSeq) phospholipase D family member 4
  KO
K16860  phospholipase D3/4 [EC:3.1.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    122618 (PLD4)
   00565 Ether lipid metabolism
    122618 (PLD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    122618 (PLD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     122618 (PLD4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    122618 (PLD4)
SSDB
Motif
Pfam: PLDc_3 PLDc_2 PLDc
Other DBs
NCBI-GeneID: 122618
NCBI-ProteinID: NP_620145
OMIM: 618488
HGNC: 23792
Ensembl: ENSG00000166428
Vega: OTTHUMG00000144167
Pharos: Q96BZ4(Tbio)
UniProt: Q96BZ4 B4DJQ6 B4DI07
Position
14q32.33
AA seq 506 aa
MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTW
GQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQ
AWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSS
PTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQV
KELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVP
TTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDN
ALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN
IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQL
FERDWSSRYAVGLDGQAPGQDCVWQG
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgctgaagcctctttggaaagcagcagtggcccccacatggccatgctccatgccgccc
cgccgcccgtgggacagagaggctggcacgttgcaggtcctgggagcgctggctgtgctg
tggctgggctccgtggctcttatctgcctcctgtggcaagtgccccgtcctcccacctgg
ggccaggtgcagcccaaggacgtgcccaggtcctgggagcatggctccagcccagcttgg
gagcccctggaagcagaggccaggcagcagagggactcctgccagcttgtccttgtggaa
agcatcccccaggacctgccatctgcagccggcagcccctctgcccagcctctgggccag
gcctggctgcagctgctggacactgcccaggagagcgtccacgtggcttcatactactgg
tccctcacagggcctgacatcggggtcaacgactcgtcttcccagctgggagaggctctt
ctgcagaagctgcagcagctgctgggcaggaacatttccctggctgtggccaccagcagc
ccgacactggccaggacatccaccgacctgcaggttctggctgcccgaggtgcccatgta
cgacaggtgcccatggggcggctcaccaggggtgttttgcactccaaattctgggttgtg
gatggacggcacatatacatgggcagtgccaacatggactggcggtctctgacgcaggtg
aaggagcttggcgctgtcatctataactgcagccacctggcccaagacctggagaagacc
ttccagacctactgggtactgggggtgcccaaggctgtcctccccaaaacctggcctcag
aacttctcatctcacttcaaccgtttccagcccttccacggcctctttgatggggtgccc
accactgcctacttctcagcgtcgccaccagcactctgtccccagggccgcacccgggac
ctggaggcgctgctggcggtgatggggagcgcccaggagttcatctatgcctccgtgatg
gagtatttccccaccacgcgcttcagccaccccccgaggtactggccggtgctggacaac
gcgctgcgggcggcagccttcggcaagggcgtgcgcgtgcgcctgctggtcggctgcgga
ctcaacacggaccccaccatgttcccctacctgcggtccctgcaggcgctcagcaacccc
gcggccaacgtctctgtggacgtgaaagtcttcatcgtgccggtggggaaccattccaac
atcccattcagcagggtgaaccacagcaagttcatggtcacggagaaggcagcctacata
ggcacctccaactggtcggaggattacttcagcagcacggcgggggtgggcttggtggtc
acccagagccctggcgcgcagcccgcgggggccacggtgcaggagcagctgcggcagctc
tttgagcgggactggagttcgcgctacgccgtcggcctggacggacaggctccgggccag
gactgcgtttggcagggctga

DBGET integrated database retrieval system