KEGG   Homo sapiens (human): 122706Help
Entry
122706            CDS       T01001                                 

Gene name
PSMB11, BETA5T
Definition
(RefSeq) proteasome subunit beta 11
  KO
K11598  20S proteasome subunit beta 11 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    122706 (PSMB11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    122706 (PSMB11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     122706 (PSMB11)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    122706 (PSMB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-GeneID: 122706
NCBI-ProteinID: NP_001093250
OMIM: 611137
HGNC: 31963
Ensembl: ENSG00000222028
Vega: OTTHUMG00000170279
Pharos: A5LHX3(Tbio)
UniProt: A5LHX3 B3KVC3
Position
14q11.2
AA seq 300 aa AA seqDB search
MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHG
VIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREG
QLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSG
SPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSD
ACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcaggatgtgtgcaagtggcagtcccctgacacccagggaccatcacctcac
ctgcctcgggctggcggctgggctgtgccccggggttgtgaccctcaaaccttcctgcag
atccatggccccagactggcccacggcaccaccactctggccttccgcttccgtcatgga
gtcattgctgcagctgacacgcgttcctcctgtggcagctatgtggcgtgtccagcctca
tgcaaggtcatccctgtgcaccagcacctcctgggtaccacctctggcacctctgccgac
tgtgctacctggtatcgggtattacagcgggagctgcggcttcgggaactgagggagggt
cagctgcccagtgtggccagtgctgccaagctcttgtcagccatgatgtctcaataccgg
ggactggatctctgtgtggccactgccctctgcggctgggaccgctctggccctgagctc
ttctacgtctatagcgacggcacccgcctgcagggggacatcttctctgtgggctctgga
tctccctatgcctacggcgtgctagaccgtggctatcgctacgacatgagcacccaggaa
gcctacgccctggctcgctgcgccgtggcccacgccacccaccgtgatgcctattcaggg
ggctctgtagaccttttccacgtgcgggagagtggatgggagcatgtgtcacgcagtgat
gcctgtgtgctgtacgtggagttacagaagctcctggagccggagccagaggaggatgcc
agccatgcccatcctgagcctgccactgcccacagagctgcagaagatagagagctctct
gtggggccaggggaggtgacaccaggagactccaggatgccagcagggactgagacggtg
tga

DBGET integrated database retrieval system